Recombinant Human C1qTNF5/CTRP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C1qTNF5/CTRP5 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 145 - 243 of Human C1QTNF5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CQVPGVYYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

Protein/Peptide Type
Partial Recombinant Protein
Gene
C1QTNF5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C1qTNF5/CTRP5 Protein

  • C1q and tumor necrosis factor related protein 5
  • C1qTNF5
  • Complement C1q Tumor Necrosis Factor-Related Protein 5 Precursor Variant 3
  • CTRP5
  • CTRP5LORDDKFZp586B0621
  • LORD 6
  • Myonectin 3

Background

The CTRP5 protein is a member of the C1q (see MIM 120550)/tumor necrosis factor (MIM 191160) superfamily, which shows diverse functions including cell adhesion and basement membrane components (Shapiro and Scherer, 1998 [PubMed 9512423]). C1QTNF5 is mutant in late-onset retinal degeneration (LORD; MIM 605670).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3445
Species: Mu
Applications: WB, IHC
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006785-Q01
Species: Hu
NBP1-77218
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP

Publications for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01) (0)

There are no publications for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01) (0)

There are no reviews for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C1qTNF5/CTRP5 Products

Bioinformatics Tool for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01)

Discover related pathways, diseases and genes to C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01)

Discover more about diseases related to C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01).
 

Pathways for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01)

View related products by pathway.

PTMs for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01)

Learn more about PTMs related to C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01).
 

Research Areas for C1qTNF5/CTRP5 Partial Recombinant Protein (H00114902-Q01)

Find related products by research area.

Blogs on C1qTNF5/CTRP5

There are no specific blogs for C1qTNF5/CTRP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C1qTNF5/CTRP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF5
Entrez