c-Myc-responsive protein Rcl Antibody (7C1Z8)

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Western blot analysis of extracts of various cell lines, using c-Myc-responsive protein Rcl antibody (NBP3-16115) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Confocal imaging of MCF7 cells using c-Myc-responsive protein Rcl Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clone: 7C1Z8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

c-Myc-responsive protein Rcl Antibody (7C1Z8) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 75-174 of human c-Myc-responsive protein Rcl (O43598). LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DNPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for c-Myc-responsive protein Rcl Antibody (7C1Z8)

• chromosome 6 open reading frame 108
• c-Myc-responsive protein Rcl
• deoxyribonucleoside 5'-monophosphate N-glycosidase
• dJ330M21.3
• EC 3.2.2
• EC 3.2.2.-
• putative c-Myc-responsive
• rcl
• RP3-330M21.3

Background

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNPH1