Bub3 Antibody (10G1S6)

Western Blot: Bub3 Antibody (10G1S6) [NBP3-16709] - Western blot analysis of extracts of various cell lines, using Bub3 Rabbit mAb (NBP3-16709) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunofluorescence analysis of U-2 OS cells using Bub3 Rabbit mAb (NBP3-16709) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunofluorescence analysis of C6 cells using Bub3 Rabbit mAb (NBP3-16709) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat brain tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded human colon carcinoma tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded human colon tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded mouse brain tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat spleen tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded mouse lung tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Bub3 Antibody (10G1S6) [NBP3-16709] - Immunohistochemistry analysis of Bub3 in paraffin-embedded rat colon tissue using Bub3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 10G1S6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Bub3 Antibody (10G1S6) Summary

• Description: Novus Biologicals Rabbit Bub3 Antibody (10G1S6) (NBP3-16709) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bub3 (O43684). MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIR
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BUB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Bub3 Antibody (10G1S6)

• BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog
• BUB3 budding uninhibited by benzimidazoles 3 homolog
• Bub3
• BUB3L
• budding uninhibited by benomyl
• budding uninhibited by benzimidazoles 3 homolog (yeast)
• hBUB3
• mitotic checkpoint component
• mitotic checkpoint protein BUB3

Background

The mitotic checkpoint protein Bub3 appears to be essential during normal mitotic progression, preventing premature sister chromatid separation, missegreation and aneuploidy. Bub3 is also important during G2 and early mitosis stages, promoting normal mitotic entry. Loss of Bub3 function causes slower progression through prophase, apparently due to mitotic cyclins A and B not being accumulated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BUB3