Bub3 Antibody (10G1S6) Summary
| Description |
Novus Biologicals Rabbit Bub3 Antibody (10G1S6) (NBP3-16709) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bub3 (O43684). MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVLDCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIR |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
BUB3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Bub3 Antibody (10G1S6)
Background
The mitotic checkpoint protein Bub3 appears to be essential during normal mitotic progression, preventing premature sister chromatid separation, missegreation and aneuploidy. Bub3 is also important during G2 and early mitosis stages, promoting normal mitotic entry. Loss of Bub3 function causes slower progression through prophase, apparently due to mitotic cyclins A and B not being accumulated.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
Species: Hu
Applications: ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu, Mar, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for Bub3 Antibody (NBP3-16709) (0)
There are no publications for Bub3 Antibody (NBP3-16709).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Bub3 Antibody (NBP3-16709) (0)
There are no reviews for Bub3 Antibody (NBP3-16709).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Bub3 Antibody (NBP3-16709) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Bub3 Products
Research Areas for Bub3 Antibody (NBP3-16709)
Find related products by research area.
|
Blogs on Bub3