BTG4 Antibody


Western Blot: BTG4 Antibody [NBP1-58173] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

BTG4 Antibody Summary

Synthetic peptides corresponding to BTG4(B-cell translocation gene 4) The peptide sequence was selected from the middle region of BTG4. Peptide sequence ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BTG4 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BTG4 Antibody

  • B-cell translocation gene 4
  • BTG family member 4
  • MGC33003
  • PC3BProtein PC3b
  • protein BTG4


The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for BTG4 Antibody (NBP1-58173) (0)

There are no publications for BTG4 Antibody (NBP1-58173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTG4 Antibody (NBP1-58173) (0)

There are no reviews for BTG4 Antibody (NBP1-58173). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG4 Antibody (NBP1-58173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BTG4 Antibody Products

Related Products by Gene

Bioinformatics Tool for BTG4 Antibody (NBP1-58173)

Discover related pathways, diseases and genes to BTG4 Antibody (NBP1-58173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG4 Antibody (NBP1-58173)

Discover more about diseases related to BTG4 Antibody (NBP1-58173).

Pathways for BTG4 Antibody (NBP1-58173)

View related products by pathway.

PTMs for BTG4 Antibody (NBP1-58173)

Learn more about PTMs related to BTG4 Antibody (NBP1-58173).

Research Areas for BTG4 Antibody (NBP1-58173)

Find related products by research area.

Blogs on BTG4

There are no specific blogs for BTG4, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our BTG4 Antibody and receive a gift card or discount.


Gene Symbol BTG4

Customers Who Bought This Also Bought