BTG4 Antibody

Images

 
Western Blot: BTG4 Antibody [NBP1-58173] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

BTG4 Antibody Summary

Immunogen
Synthetic peptides corresponding to BTG4(B-cell translocation gene 4) The peptide sequence was selected from the middle region of BTG4. Peptide sequence ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR.
Clonality
Polyclonal
Host
Rabbit
Gene
BTG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BTG4 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BTG4 Antibody

  • B-cell translocation gene 4
  • BTG family member 4
  • MGC33003
  • PC3BProtein PC3b
  • protein BTG4

Background

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55534
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89098
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13849
Species: Hu
Applications: IHC, IHC-P
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46586
Species: Hu
Applications: IHC
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1424
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24619
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-211
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IP
NBP2-01308
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77938
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr
NBP1-86308
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58173
Species: Hu
Applications: WB

Publications for BTG4 Antibody (NBP1-58173) (0)

There are no publications for BTG4 Antibody (NBP1-58173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTG4 Antibody (NBP1-58173) (0)

There are no reviews for BTG4 Antibody (NBP1-58173). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG4 Antibody (NBP1-58173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG4 Antibody Products

Related Products by Gene

Bioinformatics Tool for BTG4 Antibody (NBP1-58173)

Discover related pathways, diseases and genes to BTG4 Antibody (NBP1-58173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG4 Antibody (NBP1-58173)

Discover more about diseases related to BTG4 Antibody (NBP1-58173).
 

Pathways for BTG4 Antibody (NBP1-58173)

View related products by pathway.

PTMs for BTG4 Antibody (NBP1-58173)

Learn more about PTMs related to BTG4 Antibody (NBP1-58173).
 

Research Areas for BTG4 Antibody (NBP1-58173)

Find related products by research area.

Blogs on BTG4

There are no specific blogs for BTG4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol BTG4
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-58173 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought