Home » BTBD3 » BTBD3 Proteins » BTBD3 Recombinant Protein Antigen

BTBD3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BTBD3 Protein (NBP1-84214PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

BTBD3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTBD3.

Source: E.coli

Amino Acid Sequence: MAADIFPRKKPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAMMFNNDL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BTBD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84214.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BTBD3 Recombinant Protein Antigen

  • BTB (POZ) domain containing 3
  • BTB/POZ domain-containing protein 3
  • KIAA0952dJ742J24.1
  • MGC130038
  • MGC130039

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BMP-2
[Unconjugated]
355-BM/CF
BMP-2 [Unconjugated]
(116 Publications)
Species: Hu, Mu, Rt
Sirtuin 1/SIRT1
Antibody (1F3)
NBP1-51641
Western Blot: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Western blot analysis using SIRT1 mouse mAb against MCF-7 (1), Jurkat (2), Hela (3), HEK293 (4) and A549 (5) cell lysates.
Immunocytochemistry/Immunofluorescence: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - SIRT1 antibody was tested at 1:10 in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Immunohistochemistry-Paraffin: Sirtuin 1/SIRT1 Antibody (1F3) [NBP1-51641] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues (left) and kidney cancer tissues (right) using SIRT1 mouse mAb with DAB staining.
(1 Publication)
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
WHSC1 Antibody
NBP1-82633
Immunocytochemistry/Immunofluorescence: WHSC1 Antibody [NBP1-82633] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: WHSC1 Antibody [NBP1-82633] - Staining in human testis and liver tissues using anti-NSD2 antibody. Corresponding NSD2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: WHSC1 Antibody [NBP1-82633] - Staining of human oral mucosa shows strong nuclear positivity in squamous epithelial cells.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Immunohistochemistry-Paraffin: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of a formalin fixed paraffin embedded tissue section of human brain (Alzheimers disease, hippocampus) using 1:200 dilution of anti-beta Amyloid antibody (clone MOAB-2). The staining was developed with HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This beta Amyloid antibody specifically stained the cells with Abeta 42/ Abeta aggregates while the normal cells were negative for abeta peptide.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(12 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Semaphorin 4F
Antibody (780225)
MAB7200
Mouse cortical stem cells were stained with Rat Anti-Mouse Semaphorin 4F Monoclonal Antibody (Catalog # MAB7200, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram), followed by Allophycocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
bEnd.3 mouse endothelioma cell line was stained with Rat Anti-Mouse Semaphorin 4F Monoclonal Antibody (Catalog # MAB7200, filled histogram) or isotype control antibody (Catalog # MAB006, open histogram), followed by Allophycocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Semaphorin 4F was detected in perfusion fixed frozen sections of mouse spinal cord using Rat Anti-Mouse Semaphorin 4F Monoclonal Antibody (Catalog # MAB7200) at 25 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to synaptic puncta. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Tau Antibody (2E9)
NBP2-25162
Western Blot: Tau Antibody (2E9) [NBP2-25162] - Analysis of different tissue lysates using mouse mAb to MAP-tau, NBP2-25162, dilution 1:2,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Tau protein is expressed as up to 9 different isoforms of different molecular weight, and so appears as multiple closely spaced bands in the range from 48 kDa to 67 kDa in the CNS and including larger big tau forms in the PNS, visible in lane 5.
Immunocytochemistry/Immunofluorescence: Tau Antibody (2E9) [NBP2-25162] - Analysis of cortical neuron-glial culture from E20 rat stained with mouse mAb to MAP-tau, NBP2-25162, dilution 1:1,000 in green, and costained with chicken pAb to MAP2, dilution 1:5,000 in red. The blue is DAPI staining of nuclear DNA. NBP2-25162 antibody stains perikarya, dendrites and axons of neurons, while MAP2 antibody labels only dendrites and perikarya. As a result, perikarya and dendrites appear orange-yellow, since they contain both proteins.
Immunocytochemistry/Immunofluorescence: Tau Antibody (2E9) [NBP2-25162] - E18 primary rat hippocampal neurons (from Neuromics) were fixed and immunostained with NBP2-25162 (green), chicken antibody to alpha Internexin (NBP1-05208, red) and for DNA (blue). NBP2-25162 stains the neuronal perikarya and processes strongly, and does not stain non neuronal cells in these cultures. The alpha Internexin antibody stains intermediate or 10nm filament bundles in the cytoplasm of these cells.
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Beta Ig-h3/TGFBI
Antibody
NBP1-88606
Western Blot: Beta Ig-h3/TGFBI Antibody [NBP1-88606] - Analysis in control (vector only transfected HEK293T lysate) and TGFBI over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells.
Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP1-88606] - Staining of human endometrium shows moderate to strong membranous positivity in stromal cells.
Immunohistochemistry-Paraffin: Beta Ig-h3/TGFBI Antibody [NBP1-88606] - Staining of human placenta shows moderate to strong membranous positivity in stromal cells.
(3 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Pax5/BSAP Antibody
NBP2-38790
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining in human lymph node and cerebral cortex tissues using anti-PAX5 antibody. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry: Pax5/BSAP Antibody [NBP2-38790] - Paraffin-embedded alcohol fixed rat spleen tissue (40x). Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4C. This image was submitted via customer review.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows low expression as expected.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
NCAM-1/CD56
Antibody (123C3 (same ...
NBP2-15184
Immunohistochemistry-Paraffin: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Formalin-fixed, paraffin-embedded human colon Ganglion stained with CD56 Monoclonal Antibody (123C3.D5)
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - Analysis of Alexa Fluor (R) 700 conjugate of NBP2-15184. CD56 in human PBMC using anti-CD56 antibody. The primary antibody was used at a dilution of 1:100, incubated for 25 min at 4C in 2% human serum, 0.5 mM EDTA in DPBS. Image from verified customer rev
Flow Cytometry: NCAM-1/CD56 Antibody (123C3 (same as 123C3.D5)) [NBP2-15184] - analysis of CD56 on human monocytes using CD56 antibody at 1 ug/10^6 cells.
(1 Review)
(4 Publications)
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
RPUSD2 Antibody
NBP1-88437
Western Blot: RPUSD2 Antibody [NBP1-88437] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RPUSD2 Antibody [NBP1-88437] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
Cyclin D2 Antibody
(DCS-3.1 + DCS-5.2)
NB100-1939
Cyclin D2 Antibody (DCS-3.1 + DCS-5.2)
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
TRIM41 Antibody
NBP1-81227
Immunocytochemistry/Immunofluorescence: TRIM41 Antibody [NBP1-81227] - Staining of human cell line U-251 MG shows positivity in nucleoli.
Immunohistochemistry: TRIM41 Antibody [NBP1-81227] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PLC-beta 1 Antibody
AF4466
Western blot shows recombinant human PLC-beta 1, PLC-beta 2, PLC-beta 3, PLC-beta 4 (5 ng/lane). PVDF membrane was probed with 1 µg/mL Sheep Anti-Human/Mouse PLC‑ beta 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4466) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band for PLC‑ beta 1 was detected at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of human brain tissue and mouse brain tissue. PVDF membrane was probed with 1 µg/mL Sheep Anti-Human/Mouse PLC‑ beta 1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4466) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band for PLC‑ beta 1 was detected at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
PLEKHG6 Antibody
NBP1-83840
Western Blot: PLEKHG6 Antibody [NBP1-83840] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: PLEKHG6 Antibody [NBP1-83840] - Staining of human placenta shows strong membranous staining positivity in trophoblastic cells.
Species: Hu
Applications: WB, IHC, IHC-P
TRIM2 Antibody
NB100-1218
Western Blot: TRIM2 Antibody [NB100-1218] - Staining of Rat Brain lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: TRIM2 Antibody [NB100-1218] - Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
Tomosyn Antibody
NBP2-56176
Immunocytochemistry/Immunofluorescence: Tomosyn Antibody [NBP2-56176] - Staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining in human parathyroid gland and liver tissues using anti-STXBP5 antibody. Corresponding STXBP5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tomosyn Antibody [NBP2-56176] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Ring finger
protein 138 Overexpre ...
H00051444-T01
RNF138 transfected lysate.
Lane 1: RNF138 transfected lysate (28.2 KDa) Lane 2: Non-transfected lysate.
Species: Hu

Publications for BTBD3 Protein (NBP1-84214PEP) (0)

There are no publications for BTBD3 Protein (NBP1-84214PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD3 Protein (NBP1-84214PEP) (0)

There are no reviews for BTBD3 Protein (NBP1-84214PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for BTBD3 Protein (NBP1-84214PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BTBD3 Protein (NBP1-84214PEP)

Discover related pathways, diseases and genes to BTBD3 Protein (NBP1-84214PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD3 Protein (NBP1-84214PEP)

Discover more about diseases related to BTBD3 Protein (NBP1-84214PEP).
 

Pathways for BTBD3 Protein (NBP1-84214PEP)

View related products by pathway.

Blogs on BTBD3

There are no specific blogs for BTBD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human BTBD3 Protein
H00022903-P01-2ug
BMP-2 [Unconjugated]
355-BM-010/CF
Western Blot: BTBD3 Antibody [NBP1-84214] - Analysis in human cell line WM-115.
BTBD3 Antibody
NBP1-84214
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
beta Amyloid Antibody (MOAB-2)
NBP2-13075

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BTBD3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BTBD3