BTBD3 Antibody

Western Blot: BTBD3 Antibody [NBP1-84214] - Analysis in human cell line SK-MEL-30 and human cell line PC-3.

Immunocytochemistry/Immunofluorescence: BTBD3 Antibody [NBP1-84214] - Staining of human cell line U-2 OS shows positivity in vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BTBD3 Antibody [NBP1-84214] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Western Blot: BTBD3 Antibody [NBP1-84214] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II

Immunohistochemistry-Paraffin: BTBD3 Antibody [NBP1-84214] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: BTBD3 Antibody [NBP1-84214] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: BTBD3 Antibody [NBP1-84214] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

BTBD3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAADIFPRKKPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAMMFNNDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTBD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BTBD3 Protein (NBP1-84214PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTBD3 Antibody

• BTB (POZ) domain containing 3
• BTB/POZ domain-containing protein 3
• KIAA0952dJ742J24.1
• MGC130038
• MGC130039

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTBD3