BTBD3 Antibody

Images

 
Western Blot: BTBD3 Antibody [NBP1-84214] - Analysis in human cell line WM-115.
Immunocytochemistry/ Immunofluorescence: BTBD3 Antibody [NBP1-84214] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: BTBD3 Antibody [NBP1-84214] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: BTBD3 Antibody [NBP1-84214] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAADIFPRKKPANSSSTSVQQYHQQNLSNNNLIPAPNWQGLYPTIRERNAMMFNNDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTBD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTBD3 Protein (NBP1-84214PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD3 Antibody

  • BTB (POZ) domain containing 3
  • BTB/POZ domain-containing protein 3
  • KIAA0952dJ742J24.1
  • MGC130038
  • MGC130039

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB7200
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88606
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-88437
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-81227
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4466
Species: Hu, Mu
Applications: WB
NBP1-83840
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1218
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
NBP2-56176
Species: Hu
Applications: ICC/IF
H00051444-T01
Species: Hu

Publications for BTBD3 Antibody (NBP1-84214) (0)

There are no publications for BTBD3 Antibody (NBP1-84214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD3 Antibody (NBP1-84214) (0)

There are no reviews for BTBD3 Antibody (NBP1-84214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BTBD3 Antibody (NBP1-84214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTBD3 Products

Bioinformatics Tool for BTBD3 Antibody (NBP1-84214)

Discover related pathways, diseases and genes to BTBD3 Antibody (NBP1-84214). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTBD3 Antibody (NBP1-84214)

Discover more about diseases related to BTBD3 Antibody (NBP1-84214).
 

Pathways for BTBD3 Antibody (NBP1-84214)

View related products by pathway.

Blogs on BTBD3

There are no specific blogs for BTBD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD3