BSND Antibody - Azide and BSA Free

Western Blot: BSND Antibody [H00007809-B01P] - Analysis of BSND expression in 293.

Immunohistochemistry-Paraffin: BSND Antibody [H00007809-B01P] - Analysis of purified antibody to BSND on formalin-fixed paraffin-embedded human kidney. (antibody concentration 3 ug/ml)

Western Blot: BSND Antibody [H00007809-B01P] - Analysis of BSND expression in transfected 293T cell line by BSND polyclonal antibody. Lane 1: BSND transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BSND Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: BSND (NP_476517.1, 1 a.a. - 320 a.a.) full-length human protein. MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
• Specificity: BSND - Bartter syndrome, infantile, with sensorineural deafness (Barttin),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: BSND
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IHC-P. Use in Immunohistochemistry reported in scientific literature (PMID: 28994389).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BSND Antibody - Azide and BSA Free

• BARTMGC119284
• Bartter syndrome, infantile, with sensorineural deafness (Barttin)
• barttin
• deafness, autosomal recessive 73
• DFNB73
• MGC119283
• MGC119285

Background

This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BSND Antibody (H00007809-B01P)(1)

Publication using H00007809-B01P

• Honda K, Kim SH, Kelly MC et al. Molecular architecture underlying fluid absorption by the developing inner ear. Elife. 2017-10-10 [PMID: 28994389] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: BSND
• Entrez:
  • 7809(Human)
• Uniprot:
  • NP_476517.1(Human)