BSND Antibody

Images

 
Western Blot: BSND Antibody [H00007809-B01P] - Analysis of BSND expression in 293.
Immunohistochemistry-Paraffin: BSND Antibody [H00007809-B01P] - Analysis of purified antibody to BSND on formalin-fixed paraffin-embedded human kidney. (antibody concentration 3 ug/ml)
Western Blot: BSND Antibody [H00007809-B01P] - Analysis of BSND expression in transfected 293T cell line by BSND polyclonal antibody. Lane 1: BSND transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BSND Antibody Summary

Immunogen
BSND (NP_476517.1, 1 a.a. - 320 a.a.) full-length human protein. MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
Specificity
BSND - Bartter syndrome, infantile, with sensorineural deafness (Barttin),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BSND
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IHC-P. Use in Immunohistochemistry reported in scientific literature (PMID: 28994389).
Publications
Read Publication using
H00007809-B01P in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BSND Antibody

  • BARTMGC119284
  • Bartter syndrome, infantile, with sensorineural deafness (Barttin)
  • barttin
  • deafness, autosomal recessive 73
  • DFNB73
  • MGC119283
  • MGC119285

Background

This gene encodes an essential beta subunit for CLC chloride channels. These heteromeric channels localize to basolateral membranes of renal tubules and of potassium-secreting epithelia of the inner ear. Mutations in this gene have been associated with Bartter syndrome with sensorineural deafness. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001188-P01
Species: Hu
NBP2-92433
Species: Hu, Mu
Applications: WB
NBP1-82874
Species: Hu, Rt
Applications: IHC, IHC-P
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46541
Species: Hu
Applications: WB, Flow, IHC, IF
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60775
Species: Mu, Gp, Ha
Applications: WB, IF
NBP1-50321
Species: Hu, Ca
Applications: IHC, IHC-Fr, IHC-P, IF
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69123
Species: Mu, Rt
Applications: WB
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001181-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NLS272
Species: Hu, Mu, Rt, Ha, Pm, Rb
Applications: IHC, IHC-Fr, IHC-P

Publications for BSND Antibody (H00007809-B01P)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for BSND Antibody (H00007809-B01P) (0)

There are no reviews for BSND Antibody (H00007809-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BSND Antibody (H00007809-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BSND Products

Bioinformatics Tool for BSND Antibody (H00007809-B01P)

Discover related pathways, diseases and genes to BSND Antibody (H00007809-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BSND Antibody (H00007809-B01P)

Discover more about diseases related to BSND Antibody (H00007809-B01P).
 

Pathways for BSND Antibody (H00007809-B01P)

View related products by pathway.

PTMs for BSND Antibody (H00007809-B01P)

Learn more about PTMs related to BSND Antibody (H00007809-B01P).

Blogs on BSND

There are no specific blogs for BSND, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BSND Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BSND
Entrez
Uniprot