Recombinant Human BRSK2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BRSK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-170 of Human BRSK2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
BRSK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
44.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRSK2 Protein

  • BR serine/threonine kinase 2
  • BR serine/threonine-protein kinase 2
  • C11orf7
  • chromsosome 11 open reading frame 7
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ41362
  • PEN11BSAD1
  • protein kinase SAD1B
  • serine/threonine kinase 29
  • serine/threonine kinase SAD-A
  • Serine/threonine-protein kinase 29
  • Serine/threonine-protein kinase SAD-A
  • STK29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76778
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF1626
Species: Hu
Applications: WB, ICC
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00009024-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BRSK2 Recombinant Protein (H00009024-P01) (0)

There are no publications for BRSK2 Recombinant Protein (H00009024-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRSK2 Recombinant Protein (H00009024-P01) (0)

There are no reviews for BRSK2 Recombinant Protein (H00009024-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRSK2 Recombinant Protein (H00009024-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BRSK2 Recombinant Protein (H00009024-P01)

Discover related pathways, diseases and genes to BRSK2 Recombinant Protein (H00009024-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRSK2 Recombinant Protein (H00009024-P01)

Discover more about diseases related to BRSK2 Recombinant Protein (H00009024-P01).
 

Pathways for BRSK2 Recombinant Protein (H00009024-P01)

View related products by pathway.

PTMs for BRSK2 Recombinant Protein (H00009024-P01)

Learn more about PTMs related to BRSK2 Recombinant Protein (H00009024-P01).
 

Research Areas for BRSK2 Recombinant Protein (H00009024-P01)

Find related products by research area.

Blogs on BRSK2

There are no specific blogs for BRSK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
BRSK2 Antibody
NBP1-77281

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRSK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BRSK2