Home » BRSK1 » BRSK1 Proteins » BRSK1 Recombinant Protein Antigen

BRSK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BRSK1 Protein (NBP2-38935PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

BRSK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRSK1.

Source: E.coli

Amino Acid Sequence: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRSK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38935.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BRSK1 Recombinant Protein Antigen

  • BR serine/threonine kinase 1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43009
  • KIAA1811BR serine/threonine-protein kinase 1
  • protein kinase SAD1A
  • SAD1 kinase
  • SAD1
  • Serine/threonine-protein kinase SAD-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRSK2 Antibody
NBP1-77281
Western Blot: BRSK2 Antibody [NBP1-77281] - Analysis of BRSK2 in human brain tissue lysate with BRSK2 antibody at (A) 0.5, (B) 1 and (C) 2 ug/mL.
Immunohistochemistry: BRSK2 Antibody [NBP1-77281] - BRSK2 in human brain tissue with BRSK2 antibody at 5 ug/mL.
Immunofluorescence: BRSK2 Antibody [NBP1-77281] - BRSK2 in Human Brain cells with BRSK2 antibody at 20 ug/mL.
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
LKB1/STK11 Antibody
NBP2-14834
Western Blot: LKB1 Antibody [NBP2-14834] - LKB1 antibody was tested in human fetal liver lysate.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14834] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14834] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AMPK alpha 1
Antibody (2B7)
NBP2-22127
Western Blot: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Western blot analysis using AMPK alpha 1 mouse mAb against Jurkat (1), Hela (2), HepG2 (3), MCF-7 (4), Cos7 (5), NIH/3T3 (6), K562 (7), HEK293 (8), and PC-12 (9) cell lysate.
Immunocytochemistry/Immunofluorescence: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunofluorescence analysis of NTERA-2 cells using AMPK alpha 1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Immunohistochemical analysis of paraffin-embedded ovarian cancer (left) and brain tissues (right) using AMPK alpha 1 mouse mAb with DAB staining.
(8 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Western Blot: Chk2 Antibody (73C175.1.1) - Azide Free [NBP2-27403] - analysis of Chk2 in 293 cell lysate. A protein band of approximate molecular weight of 60-62 kDa is detected with Chk2 antibody at 2 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: Chk2 Antibody (73C175.1.1) [NB100-56546] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Chk2 (73C175.1.1) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Chk2 Antibody (73C175.1.1) [NB100-56546] - Staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using ATM antibody [NB100-104]. Theoretical molecular weight 351 kDa.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton X-100. Then cells were incubated with ATM Antibody [NB100-104] at a 1:100 dilution overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(88 Publications)
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
ATR Antibody (2B5)
NB100-308
Western Blot: ATR Antibody (2B5) [NB100-308] - Human Raji whole cell extract. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
(18 Publications)
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
Wee1 Antibody
NBP1-33506
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membranes were blotted with WEE1 antibody [N3C2], Internal diluted at 1:1000 and competitor's antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Wee1 Antibody [NBP1-33506] - Paraffin-embedded CL1-0 Xenograft, using antibody at 1:100 dilution.
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with WEE1 antibody [N3C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
(2 Publications)
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
RAP1A Antibody
(1D4-1A3)
NBP2-22527
Western Blot: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of 25 ug of various whole cell lysate per well.
Immunocytochemistry/Immunofluorescence: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 (green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% BSA/TBST for 15 minutes at room temperature. Cells were probed with a Rap1 monoclonal antibody at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis showing staining in the cytoplasm and membrane of human colon carcinoma (right) compared to a negative control without primary antibody (left).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
TERF2IP Antibody
NB100-292
Western Blot: TERF2IP Antibody [NB100-292] - Detection of Human RAP1 by Western Blot. Samples: Whole cell lysate (15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RAP1 antibody NB100-292 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: TERF2IP Antibody [NB100-292] - Sections of human lung carcinoma.~~ Antibody: Affinity purified rabbit anti-RAP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunoprecipitation: TERF2IP Antibody [NB100-292] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinitypurified rabbit anti-RAP1 antibody used for IP at 6 ug per reaction. RAP1 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-RAP1 antibody. For blotting immunoprecipitated RAP1, was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(19 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Rabex5 Antibody
NBP1-49938
Western Blot: Rabex5 Antibody [NBP1-49938] - Detection of Human and Mouse RABGEF1 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RABGEF1 antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. RABGEF1 was also immunoprecipitated by rabbit anti-RABGEF1 antibody which recognizes a downstream epitope. For blotting immunoprecipitated RABGEF1 was used. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
Immunohistochemistry-Paraffin: Rabex5 Antibody [NBP1-49938] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RABGEF1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
ABH1 Antibody
H00008846-B01P
Western Blot: ABH1 Antibody [H00008846-B01P] - Analysis of ALKBH1 expression in transfected 293T cell line by ALKBH1 polyclonal antibody. Lane 1: ALKBH transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. (antibody concentration 3 ug/ml)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MARK1 Antibody
NBP1-02673
Immunohistochemistry-Paraffin: MARK1 Antibody [NBP1-02673] - Staining of human brain, caduate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Hu, Bt, Bv, Ca, Pm, Pm, Rb
Applications: IHC, IHC-P
MARK2 [p Thr595]
Antibody
NBP1-78028
Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: wild type Jurkat cells. Lane 2: wild type Jurkat cells stimulated with CD3/CD28 (T-cell receptor stimulation). Load: 35 ug per lane. Used at a dilution of 1:500 for overnight at 4C.
Western Blot: MARK2 [p Thr595] Antibody [NBP1-78028] - Lane 1: 293T cells untransfected. Lane 2: 293T cells transfected with MARK2 and PKC-zeta. Lane 3: 293T cells transfected with MARK2. Load: 35 ug per lane. Used at a dilution of 1:1000 for overnight at 4C.
(1 Review)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
TSC1 Antibody
NB100-2315
Western Blot: TSC1 Antibody [NB100-2315] - Detection of Human and Mouse TSC1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified goat anti-TSC1 antibody NB100-2315 used for WB at 0.05 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TSC1 Antibody [NB100-2315] - Detection of Human and Mouse TSC1 on HeLa whole cell lysate using NB100-2315.
(3 Publications)
Species: Hu, Mu
Applications: WB, IP
BRSK1 Recombinant
Protein Antigen
NBP2-38935PEP
BRSK1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BRSK1 Protein (NBP2-38935PEP) (0)

There are no publications for BRSK1 Protein (NBP2-38935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRSK1 Protein (NBP2-38935PEP) (0)

There are no reviews for BRSK1 Protein (NBP2-38935PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRSK1 Protein (NBP2-38935PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional BRSK1 Products

Array NBP2-38935PEP

Bioinformatics Tool for BRSK1 Protein (NBP2-38935PEP)

Discover related pathways, diseases and genes to BRSK1 Protein (NBP2-38935PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRSK1 Protein (NBP2-38935PEP)

Discover more about diseases related to BRSK1 Protein (NBP2-38935PEP).
 

Pathways for BRSK1 Protein (NBP2-38935PEP)

View related products by pathway.

PTMs for BRSK1 Protein (NBP2-38935PEP)

Learn more about PTMs related to BRSK1 Protein (NBP2-38935PEP).

Blogs on BRSK1

There are no specific blogs for BRSK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using ATM antibody [NB100-104]. Theoretical molecular weight 351 kDa.
ATM Antibody
NB100-104

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRSK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BRSK1