Home » BRSK1 » BRSK1 Proteins » BRSK1 Recombinant Protein Antigen

BRSK1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BRSK1 Protein (NBP2-38935PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

BRSK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRSK1.

Source: E.coli

Amino Acid Sequence: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRSK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38935.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for BRSK1 Recombinant Protein Antigen

  • BR serine/threonine kinase 1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43009
  • KIAA1811BR serine/threonine-protein kinase 1
  • protein kinase SAD1A
  • SAD1 kinase
  • SAD1
  • Serine/threonine-protein kinase SAD-B

Background

BRSK1 is required for the polarization of forebrain neurons which endows axons and dendrites with distinct properties,possibly by locally regulating phosphorylation of microtubule-associated proteins . May be involved inthe regulation of G2/M arrest in response to

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BRSK2 Antibody -
BSA Free
NBP1-77281
Immunofluorescence: BRSK2 Antibody [NBP1-77281] - BRSK2 in Human Brain cells with BRSK2 antibody at 20 ug/mL.
Western Blot: BRSK2 Antibody [NBP1-77281] - Analysis of BRSK2 in human brain tissue lysate with BRSK2 antibody at (A) 0.5, (B) 1 and (C) 2 ug/mL.
Immunohistochemistry: BRSK2 Antibody [NBP1-77281] - BRSK2 in human brain tissue with BRSK2 antibody at 5 ug/mL.
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
LKB1/STK11
Antibody - BSA Free
NBP2-14835
Western Blot: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in human testes lysate.
Immunohistochemistry-Paraffin: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in mouse stomach using DAB with hematoxylin counterstain.
Immunocytochemistry/Immunofluorescence: LKB1 Antibody [NBP2-14835] - LKB1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for AMPK alpha 2 at approximately 63 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
AMPK alpha 2 was detected in immersion fixed HEK293 human embryonic kidney cell line using Goat Anti-Human/Mouse/Rat AMPK alpha 2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2850) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - An intracellular stain was performed on RH-30 cells with AMPK alpha 1 Antibody (2B7) NBP2-22127PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - An intracellular stain was performed on NIH3T3 cells with AMPK alpha 1 Antibody (2B7) NBP2-22127 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
ELISA: AMPK alpha 1 Antibody (2B7) [NBP2-22127] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng).
(11 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK beta 1
Antibody (2C3)
H00005564-M02
Western Blot: AMPK beta 1 Antibody (2C3) [H00005564-M02] - PRKAB1 monoclonal antibody (M02), clone 2C3 Analysis of PRKAB1 expression in HeLa.
Immunocytochemistry/Immunofluorescence: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Analysis of monoclonal antibody to PRKAB1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: AMPK beta 1 Antibody (2C3) [H00005564-M02] - Detection limit for recombinant GST tagged PRKAB1 is approximately 0.1ng/ml as a capture antibody.
(1 Review)
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line untreated (-) or treated (+) with 1 µM camptothecin (CPT) for 1 hour. PVDF membrane was probed with 0.5 µg/mL Rabbit Anti-Human Phospho‑Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-Chk2 (T68) was detected at approximately 64 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for  60 minutes. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Phopsho-Chk2 (T68) was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line treated with 1 µM camptothecin using Rabbit Anti-Human Phospho-Chk2 (T68) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1626) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to nuclei in treated cells. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Publications)
Species: Hu
Applications: ICC, WB
ATM Antibody
NB100-104
Flow Cytometry: ATM Antibody [NB100-104] - Analysis of PE conjugate of ATM Antibody [NB100-104PE]. An intracellular stain was performed on HeLa cells with ATM antibody [NB100-104PE] (blue) and a matched isotype control [NBP2-24893PE] (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Flow Cytometry: ATM Antibody [NB100-104] - An intracellular stain was performed on HepG2 cells with PE-conjugated ATM antibody [NB100-104PE] (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(96 Publications)
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/Immunofluorescence: ATR Antibody (2B5) [NB100-308] - Analysis of HeLa, using antibody at 1:100 dilution.
Western Blot: ATR Antibody (2B5) [NB100-308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody [2B5] diluted at 1:500.
Western Blot: ATR Antibody (2B5) [NB100-308] - Raji whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATR antibody diluted at 1:500.
(19 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Wee1 Antibody
NBP1-33506
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with WEE1 antibody [N3C2], diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Wee1 Antibody [NBP1-33506] - CL1-0 Xenograft, using WEE1 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Wee1 Antibody [NBP1-33506] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membranes were blotted with WEE1 antibody [N3C2], Internal diluted at 1:1000.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(6 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
RAP1A Antibody
(1D4-1A3)
NBP2-22527
Immunoprecipitation: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 was performed on NIH3T3 cells. Antigen-antibody complexes were formed by incubating 750ug of NIH3T3 whole cell lysate with 2ug of a Rap1 monoclonal antibody overnight on a rocking platform at 4C. The immune complexes were captured on 50ul Protein A/G Plus Agarose, washed extensively, and eluted with 5X Lane Marker Reducing Sample BUffer. Eluted sample (right lane) and 25ug of NIH3T3 control lysate (left lane) were resolved on a 4-20% Tris-HCl polyacrylamide gel, transferred to a PVDF membrane, and blocked with 5% BSA/TBS-0.1%Tween for at least 1 hour. The membrane was probed with a Rap1 monoclonal antibody at a dilution of 1:500 overnight rotating at 4C, washed in TBST, and probed with Clean-Blot IP Detection Reagent at a dilution of 1:2500 for at least 1 hour. Chemiluminescent detection was performed using SuperSignal West Dura.
Immunocytochemistry/Immunofluorescence: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis of Rap1 (green) in HeLa cells. Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% BSA/TBST for 15 minutes at room temperature. Cells were probed with a Rap1 monoclonal antibody at a dilution of 1:100 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488-conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
Immunohistochemistry-Paraffin: RAP1A Antibody (1D4-1A3) [NBP2-22527] - Analysis showing staining in the cytoplasm and membrane of human kidney tissue (right) compared to a negative control without primary antibody (left).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
TERF2IP Antibody
NB100-292
Immunohistochemistry-Paraffin: TERF2IP Antibody [NB100-292] - Sections of human lung carcinoma.~~ Antibody: Affinity purified rabbit anti-RAP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Immunoprecipitation: TERF2IP Antibody [NB100-292] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinitypurified rabbit anti-RAP1 antibody used for IP at 6 ug per reaction. RAP1 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-RAP1 antibody. For blotting immunoprecipitated RAP1, was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: TERF2IP Antibody [NB100-292] - Detection of Human RAP1 by Western Blot. Samples: Whole cell lysate (15 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RAP1 antibody NB100-292 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
(19 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Rabex5 Antibody
NBP1-49938
Western Blot: Rabex5 Antibody [NBP1-49938] - RABGEF1 is important for mitochondrial clearance. YFP-Parkin stably expressing WT and RABGEF1-mAID HCT116 cells pre-treated with IAA were treated with valinomycin for the indicated times. Total cell lysates were analyzed by immunoblotting. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/31326), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Rabex5 Antibody [NBP1-49938] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti- RABGEF1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Rabex5 Antibody [NBP1-49938] - Detection of Human and Mouse RABGEF1 by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg) and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RABGEF1 antibody used for WB at 0.1 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate. RABGEF1 was also immunoprecipitated by rabbit anti-RABGEF1 antibody which recognizes a downstream epitope. For blotting immunoprecipitated RABGEF1 was used. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
ABH1 Antibody
(5K4W5)
NBP3-16787
Immunohistochemistry-Paraffin: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunohistochemistry of paraffin-embedded mouse brain using ABH1 Rabbit mAb (NBP3-16787) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunohistochemistry of paraffin-embedded rat kidney using ABH1 Rabbit mAb (NBP3-16787) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: ABH1 Antibody (5K4W5) [NBP3-16787] - Immunofluorescence analysis of C6 cells using ABH1 antibody (NBP3-16787) at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MARK1 Antibody
NBP1-33409
Immunocytochemistry/Immunofluorescence: MARK1 Antibody [NBP1-33409] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: MARK1 Antibody [NBP1-33409] - Sample (30 ug of whole cell lysate) A: A431 7. 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu
Applications: ICC/IF, WB
MARK2 Antibody
(3B12)
H00002011-M01
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in NIH/3T3.
ELISA: MARK2 Antibody (3B12) [H00002011-M01] - Detection limit for recombinant GST tagged MARK2 is approximately 0.03ng/ml as a capture antibody.
Western Blot: MARK2 Antibody (3B12) [H00002011-M01] - MARK2 monoclonal antibody (M01), clone 3B12. Analysis of MARK2 expression in PC-12.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
TSC1 Antibody
(OTI3A2)
NBP2-46234
Immunohistochemistry: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: TSC1 Antibody (3A2) [NBP2-46234] - Analysis of Human adult heart tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu, Mu, Rt
Applications: IHC, WB
BRSK1 Recombinant
Protein Antigen
NBP2-38935PEP
BRSK1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BRSK1 Protein (NBP2-38935PEP) (0)

There are no publications for BRSK1 Protein (NBP2-38935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRSK1 Protein (NBP2-38935PEP) (0)

There are no reviews for BRSK1 Protein (NBP2-38935PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRSK1 Protein (NBP2-38935PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRSK1 Products

Array NBP2-38935PEP

Bioinformatics Tool for BRSK1 Protein (NBP2-38935PEP)

Discover related pathways, diseases and genes to BRSK1 Protein (NBP2-38935PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRSK1 Protein (NBP2-38935PEP)

Discover more about diseases related to BRSK1 Protein (NBP2-38935PEP).
 

Pathways for BRSK1 Protein (NBP2-38935PEP)

View related products by pathway.

PTMs for BRSK1 Protein (NBP2-38935PEP)

Learn more about PTMs related to BRSK1 Protein (NBP2-38935PEP).
 

Research Areas for BRSK1 Protein (NBP2-38935PEP)

Find related products by research area.

Blogs on BRSK1

There are no specific blogs for BRSK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: ATM Antibody [NB100-104] - Analysis of PE conjugate of ATM Antibody [NB100-104PE]. An intracellular stain was performed on HeLa cells with ATM antibody [NB100-104PE] (blue) and a matched isotype control [NBP2-24893PE] (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin.
ATM Antibody
NB100-104

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRSK1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BRSK1