BRSK1 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRSK1. Source: E.coli
Amino Acid Sequence: VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
BRSK1 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP2-38935.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for BRSK1 Recombinant Protein Antigen
Background
BRSK1 is required for the polarization of forebrain neurons which endows axons and dendrites with distinct properties,possibly by locally regulating phosphorylation of microtubule-associated proteins . May be involved inthe regulation of G2/M arrest in response to
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC, WB
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: AC
Publications for BRSK1 Protein (NBP2-38935PEP) (0)
There are no publications for BRSK1 Protein (NBP2-38935PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BRSK1 Protein (NBP2-38935PEP) (0)
There are no reviews for BRSK1 Protein (NBP2-38935PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for BRSK1 Protein (NBP2-38935PEP) (0)
Additional BRSK1 Products
Bioinformatics Tool for BRSK1 Protein (NBP2-38935PEP)
Discover related pathways, diseases and genes to BRSK1 Protein (NBP2-38935PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for BRSK1 Protein (NBP2-38935PEP)
Discover more about diseases related to BRSK1 Protein (NBP2-38935PEP).
| | Pathways for BRSK1 Protein (NBP2-38935PEP)
View related products by pathway.
|
PTMs for BRSK1 Protein (NBP2-38935PEP)
Learn more about PTMs related to BRSK1 Protein (NBP2-38935PEP).
| | Research Areas for BRSK1 Protein (NBP2-38935PEP)
Find related products by research area.
|
Blogs on BRSK1