Recombinant Human BRMS1L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BRMS1L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human BRMS1L full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRMECLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSELWNDELQSRKKRKDPFSPDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSIKHS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BRMS1L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRMS1L Protein

  • breast cancer metastasis-suppressor 1
  • breast cancer metastasis-suppressor 1-like protein
  • breast cancer metastasis-suppressor 1-like
  • BRMS1
  • BRMS1-homolog protein p40
  • BRMS1-like protein p40
  • FLJ39177
  • MGC11296

Background

The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-45672
Species: Hu, Mu, Rt
Applications: WB
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056547-M01
Species: Hu
Applications: WB, ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for BRMS1L Recombinant Protein (H00084312-P01) (0)

There are no publications for BRMS1L Recombinant Protein (H00084312-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRMS1L Recombinant Protein (H00084312-P01) (0)

There are no reviews for BRMS1L Recombinant Protein (H00084312-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRMS1L Recombinant Protein (H00084312-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRMS1L Products

BRMS1L H00084312-P01

Bioinformatics Tool for BRMS1L Recombinant Protein (H00084312-P01)

Discover related pathways, diseases and genes to BRMS1L Recombinant Protein (H00084312-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRMS1L Recombinant Protein (H00084312-P01)

Discover more about diseases related to BRMS1L Recombinant Protein (H00084312-P01).

Research Areas for BRMS1L Recombinant Protein (H00084312-P01)

Find related products by research area.

Blogs on BRMS1L

There are no specific blogs for BRMS1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRMS1L Antibody
NBP2-14362

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRMS1L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BRMS1L