BRF2 Antibody

Images

 
Western Blot: BRF2 Antibody [NBP1-88355] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: BRF2 Antibody [NBP1-88355] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BRF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BRF2 Protein (NBP1-88355PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BRF2 Antibody

  • B-related factor 2
  • BRF-2
  • BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like
  • BRFUhTFIIIB50
  • FLJ11052
  • hBRFU
  • TFIIIB50RNA polymerase III transcription initiation factor BRFU
  • transcription factor IIB- related factor, TFIIIB50
  • transcription factor IIIB 50 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55335
Species: Hu
Applications: WB, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
H00055814-R01
Species: Hu
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00006621-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-58560
Species: Hu
Applications: ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-31617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BRF2 Antibody (NBP1-88355) (0)

There are no publications for BRF2 Antibody (NBP1-88355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRF2 Antibody (NBP1-88355) (0)

There are no reviews for BRF2 Antibody (NBP1-88355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRF2 Antibody (NBP1-88355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRF2 Products

Bioinformatics Tool for BRF2 Antibody (NBP1-88355)

Discover related pathways, diseases and genes to BRF2 Antibody (NBP1-88355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRF2 Antibody (NBP1-88355)

Discover more about diseases related to BRF2 Antibody (NBP1-88355).
 

Pathways for BRF2 Antibody (NBP1-88355)

View related products by pathway.

PTMs for BRF2 Antibody (NBP1-88355)

Learn more about PTMs related to BRF2 Antibody (NBP1-88355).

Blogs on BRF2

There are no specific blogs for BRF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRF2