SNAPC4 Antibody (1D1)

Images

 
Immunocytochemistry/ Immunofluorescence: SNAPC4 Antibody (1D1) [H00006621-M01] - Analysis of monoclonal antibody to SNAPC4 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SNAPC4 Antibody (1D1) [H00006621-M01] - Analysis of monoclonal antibody to SNAPC4 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml.
Sandwich ELISA: SNAPC4 Antibody (1D1) [H00006621-M01] - Detection limit for recombinant GST tagged SNAPC4 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNAPC4 Antibody (1D1) Summary

Immunogen
SNAPC4 (NP_003077, 53 a.a. - 162 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN
Specificity
SNAPC4 - small nuclear RNA activating complex, polypeptide 4, 190kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNAPC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNAPC4 Antibody (1D1)

  • FLJ13451
  • Proximal sequence element-binding transcription factor subunit alpha
  • PSE-binding factor subunit alpha
  • PTF subunit alpha
  • PTFalpha
  • small nuclear RNA activating complex, polypeptide 4, 190kD
  • small nuclear RNA activating complex, polypeptide 4, 190kDa
  • SNAP190SNAPc 190 kDa subunit
  • SNAPc subunit 4
  • snRNA-activating protein complex 190 kDa subunit
  • snRNA-activating protein complex subunit 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58560
Species: Hu
Applications: ICC/IF
NBP2-57713
Species: Hu
Applications: WB, ICC/IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45374
Species: Hu
Applications: WB, IHC
NBP2-55746
Species: Hu
Applications: ICC/IF
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-47267
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
H00055814-R01
Species: Hu
NBP2-15617
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026469-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF

Publications for SNAPC4 Antibody (H00006621-M01) (0)

There are no publications for SNAPC4 Antibody (H00006621-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAPC4 Antibody (H00006621-M01) (0)

There are no reviews for SNAPC4 Antibody (H00006621-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNAPC4 Antibody (H00006621-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAPC4 Products

Bioinformatics Tool for SNAPC4 Antibody (H00006621-M01)

Discover related pathways, diseases and genes to SNAPC4 Antibody (H00006621-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAPC4 Antibody (H00006621-M01)

Discover more about diseases related to SNAPC4 Antibody (H00006621-M01).
 

Pathways for SNAPC4 Antibody (H00006621-M01)

View related products by pathway.

PTMs for SNAPC4 Antibody (H00006621-M01)

Learn more about PTMs related to SNAPC4 Antibody (H00006621-M01).

Blogs on SNAPC4

There are no specific blogs for SNAPC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAPC4 Antibody (1D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAPC4
Entrez
OMIM
Uniprot