BDP1 Antibody - Azide and BSA Free

Western Blot: BDP1 Antibody [H00026469-B01P] - Analysis of PTPN18 expression in transfected 293T cell line by PTPN18 polyclonal antibody. Lane 1: PTPN18 transfected lysate(38.61 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: BDP1 Antibody [H00026469-B01P] - Analysis of purified antibody to PTPN18 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BDP1 Antibody - Azide and BSA Free Summary

• Immunogen: PTPN18 (AAH52800.1, 1 a.a. - 351 a.a.) full-length human protein. MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PTPN18
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Immunofluorescence

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BDP1 Antibody - Azide and BSA Free

• BDP1
• EC 3.1.3.48
• protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
• PTPN18
• tyrosine-protein phosphatase non-receptor type 18

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This gene was found to be expressed in brain, colon tissues, and several different tumor-derived cell lines. The bilogical function of this PTP has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BDP1 Antibody (H00026469-B01P)(1)

Publication using H00026469-B01P

• Sztacho M, Segeletz S, Sanchez-Fernandez MA et al. BAR Proteins PSTPIP1/2 Regulate Podosome Dynamics and the Resorption Activity of Osteoclasts. PLoS One 2016-10-19 [PMID: 27760174]

Bioinformatics

• Gene Symbol: PTPN18
• Uniprot:
  • AAH52800.1(Human)