Recombinant Human Breast cancer suppressor candidate 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Breast cancer suppressor candidate 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 332 - 415 of Human LOH11CR2A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VWA5A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Breast cancer suppressor candidate 1 Protein

  • BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein
  • BCSC1ortholog of mouse AW551984
  • Breast cancer suppressor candidate 1
  • LOH11CR2Avon Willebrand factor A domain-containing protein 5A
  • loss of heterozygosity, 11, chromosomal region 2, gene A
  • von Willebrand factor A domain containing 5A

Background

LOH11CR2A - loss of heterozygosity, 11, chromosomal region 2, gene A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-48993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02434
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF756
Species: Mu
Applications: WB, IHC
AF3155
Species: Mu
Applications: WB, IHC
AF2864
Species: Hu
Applications: WB, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-02902
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-46429
Species: Hu
Applications: WB, IHC, IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB110-58778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
H00004013-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01) (0)

There are no publications for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01) (0)

There are no reviews for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Breast cancer suppressor candidate 1 Products

Bioinformatics Tool for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01)

Discover related pathways, diseases and genes to Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01)

Discover more about diseases related to Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01).
 

Pathways for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01)

View related products by pathway.

PTMs for Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01)

Learn more about PTMs related to Breast cancer suppressor candidate 1 Partial Recombinant Protein (H00004013-Q01).

Blogs on Breast cancer suppressor candidate 1

There are no specific blogs for Breast cancer suppressor candidate 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Breast cancer suppressor candidate 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VWA5A