Recombinant Human BPOZ Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BPOZ Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 271-370 of Human BPOZ

Source: Wheat Germ

Amino Acid Sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ABTB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BPOZ Protein

  • ankyrin repeat and BTB (POZ) domain containing 1
  • ankyrin repeat and BTB/POZ domain-containing protein 1
  • BPOZMGC20585
  • BTB3
  • EF1ABP
  • elongation factor 1A binding protein
  • Elongation factor 1A-binding protein

Background

ABTB1 - ankyrin repeat and BTB (POZ) domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA
NB110-77345
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-58788
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
AF5789
Species: Hu, Mu, Rt
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
MAB8570
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-13305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19708
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58876
Species: Hu
Applications: ICC/IF
NBP1-18979
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP1-90068
Species: Hu
Applications: IHC, IHC-P

Publications for BPOZ Partial Recombinant Protein (H00080325-Q01) (0)

There are no publications for BPOZ Partial Recombinant Protein (H00080325-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPOZ Partial Recombinant Protein (H00080325-Q01) (0)

There are no reviews for BPOZ Partial Recombinant Protein (H00080325-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BPOZ Partial Recombinant Protein (H00080325-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for BPOZ Partial Recombinant Protein (H00080325-Q01)

Discover related pathways, diseases and genes to BPOZ Partial Recombinant Protein (H00080325-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPOZ Partial Recombinant Protein (H00080325-Q01)

Discover more about diseases related to BPOZ Partial Recombinant Protein (H00080325-Q01).
 

Pathways for BPOZ Partial Recombinant Protein (H00080325-Q01)

View related products by pathway.

PTMs for BPOZ Partial Recombinant Protein (H00080325-Q01)

Learn more about PTMs related to BPOZ Partial Recombinant Protein (H00080325-Q01).

Blogs on BPOZ

There are no specific blogs for BPOZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NAC1 Antibody (3)
NB110-77345
BPOZ Antibody
NB100-836
EGR2 Antibody
NB100-92327

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BPOZ Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABTB1