Recombinant Human BORIS Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BORIS Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 193 - 293 of Human CTCFL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CTCFL
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BORIS Protein

  • BORISHMGB1L1
  • BORIS-like protein
  • Brother of the regulator of imprinted sites
  • Cancer/testis antigen 27
  • CCCTC-binding factor (zinc finger protein)-like
  • CCCTC-binding factor
  • CT27MGC163358
  • CTCF paralog
  • CTCF-like protein
  • CTCF-T
  • dJ579F20.2
  • HMG-1L1
  • MGC169105
  • MGC169106
  • putative high mobility group protein 1-like 1
  • putative high mobility group protein B1-like 1
  • transcriptional repressor CTCFL
  • Zinc finger protein CTCF-T

Background

CTCFL - CCCTC-binding factor (zinc finger protein)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
17190002
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BORIS Partial Recombinant Protein (H00140690-Q01) (0)

There are no publications for BORIS Partial Recombinant Protein (H00140690-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BORIS Partial Recombinant Protein (H00140690-Q01) (0)

There are no reviews for BORIS Partial Recombinant Protein (H00140690-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BORIS Partial Recombinant Protein (H00140690-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BORIS Products

Bioinformatics Tool for BORIS Partial Recombinant Protein (H00140690-Q01)

Discover related pathways, diseases and genes to BORIS Partial Recombinant Protein (H00140690-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BORIS Partial Recombinant Protein (H00140690-Q01)

Discover more about diseases related to BORIS Partial Recombinant Protein (H00140690-Q01).
 

Pathways for BORIS Partial Recombinant Protein (H00140690-Q01)

View related products by pathway.

PTMs for BORIS Partial Recombinant Protein (H00140690-Q01)

Learn more about PTMs related to BORIS Partial Recombinant Protein (H00140690-Q01).

Blogs on BORIS

There are no specific blogs for BORIS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BORIS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CTCFL