Recombinant Human BNP Protein

Product Discontinued

Recombinant Human BNP Protein Summary

• Description: Synthetic BNP
  
  

  Source:Synthetic
  Amino Acid Sequence:(P16860) - SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH

• Preparation Method: Determined to be >98% pure by SDS-PAGE
• Details of Functionality: Binds and activates the atrial natriuretic factor receptors
• Source: Synthetic
• Protein/Peptide Type: Recombinant Protein
• Gene: NPPB
• Purity: >98%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • Bioactivity
  • SDS-Page
• Theoretical MW: 3.464 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20 to -80C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized with no additives.
• Concentration: Lyoph
• Purity: >98%, by SDS-PAGE
• Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile H2O to >100 ug/ml. This solution can then be diluted into other aqueous buffers.

Alternate Names for Recombinant Human BNP Protein

• BNF
• BNP
• brain type natriuretic peptide
• Gamma-brain natriuretic peptide
• natriuretic peptide B
• natriuretic peptide precursor B
• natriuretic peptides B
• natriuretic protein
• NPPB

Background

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H2O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for BNP Recombinant Protein (NBP1-99567). (Showing 1 - 1 of 1 FAQ).

1. We are searching for human Brain Natriuretic Peptide (BNP) (aa1-32), cyclic. Is your product NBP-99567 cyclic or could you offer this kind of product?
   • NBP1-99567 should not be cyclic and this is not something we can offer at this time. I apologize for the inconvenience.

Bioinformatics

• Gene Symbol: NPPB