Recombinant Human BNP Protein Summary
| Description |
Synthetic BNP Source:Synthetic Amino Acid Sequence:(P16860) - SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH |
Preparation Method |
Determined to be >98% pure by SDS-PAGE |
| Details of Functionality |
Binds and activates the atrial natriuretic factor receptors |
| Source |
Synthetic |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
NPPB |
| Purity |
>98%, by SDS-PAGE |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
3.464 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20 to -80C. Avoid freeze-thaw cycles. |
| Buffer |
Lyophilized with no additives. |
| Concentration |
Lyoph |
| Purity |
>98%, by SDS-PAGE |
| Reconstitution Instructions |
Centrifuge the vial prior to opening. Reconstitute in sterile H2O to >100 ug/ml. This solution can then be diluted into other aqueous buffers. |
Alternate Names for Recombinant Human BNP Protein
Background
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and H2O balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu, Mu, Rb, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, WB
Publications for BNP Recombinant Protein (NBP1-99567) (0)
There are no publications for BNP Recombinant Protein (NBP1-99567).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BNP Recombinant Protein (NBP1-99567) (0)
There are no reviews for BNP Recombinant Protein (NBP1-99567).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Additional BNP Products
Research Areas for BNP Recombinant Protein (NBP1-99567)
Find related products by research area.
|
Blogs on BNP