BNP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BNP Source: E.coli
Amino Acid Sequence: LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NPPB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25300It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for BNP Recombinant Protein Antigen
Background
Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C-type natriuretic peptide (CNP) and urodilatin. These peptides are characterized by a common 17 amino acid ring structure with a disulfide bond between two cystein residues. This ring structure shows high homology between different natriuretic peptides (eleven of the 17 amino acid residues are homologous in the ring of each of the natriuretic peptides, see fig. 18). BNP is a 32 amino acid peptide with disulfide bond between the cystein residues Cys10 and Cys26. In earlier studies it has been demonstrated that BNP concentration in blood increases with the severity of congestive heart failure. Quantitative measurement of BNP in blood provides an objective indicator of congestive heart failure severity
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rb, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, WB
Publications for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)
There are no publications for BNP Recombinant Protein Antigen (NBP3-25300PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)
There are no reviews for BNP Recombinant Protein Antigen (NBP3-25300PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)
Additional BNP Products
Research Areas for BNP Recombinant Protein Antigen (NBP3-25300PEP)
Find related products by research area.
|
Blogs on BNP