BNP Recombinant Protein Antigen

Images

 
There are currently no images for BNP Recombinant Protein Antigen (NBP3-25300PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BNP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BNP

Source: E.coli

Amino Acid Sequence: LGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
NPPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25300It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BNP Recombinant Protein Antigen

  • BNF
  • BNP
  • brain type natriuretic peptide
  • Gamma-brain natriuretic peptide
  • natriuretic peptide B
  • natriuretic peptide precursor B
  • natriuretic peptides B
  • natriuretic protein
  • NPPB

Background

Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C-type natriuretic peptide (CNP) and urodilatin. These peptides are characterized by a common 17 amino acid ring structure with a disulfide bond between two cystein residues. This ring structure shows high homology between different natriuretic peptides (eleven of the 17 amino acid residues are homologous in the ring of each of the natriuretic peptides, see fig. 18). BNP is a 32 amino acid peptide with disulfide bond between the cystein residues Cys10 and Cys26. In earlier studies it has been demonstrated that BNP concentration in blood increases with the severity of congestive heart failure. Quantitative measurement of BNP in blood provides an objective indicator of congestive heart failure severity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
AF2905
Species: Hu
Applications: ELISA, ICC, WB
NBP1-31333
Species: Hu, Mu, Rb, Rt
Applications: WB
QET00B
Species: Hu
Applications: ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
M6000B
Species: Mu
Applications: ELISA
NBP3-12239
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF009
Species: Hu
Applications: IHC, WB

Publications for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)

There are no publications for BNP Recombinant Protein Antigen (NBP3-25300PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)

There are no reviews for BNP Recombinant Protein Antigen (NBP3-25300PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BNP Recombinant Protein Antigen (NBP3-25300PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BNP Products

Research Areas for BNP Recombinant Protein Antigen (NBP3-25300PEP)

Find related products by research area.

Blogs on BNP

There are no specific blogs for BNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BNP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NPPB