BNP Antibody

Images

 
Western Blot: BNP Antibody [H00004879-D01P] - Analysis of NPPB expression in transfected 293T cell line by NPPB polyclonal antibody.Lane 1: NPPB transfected lysate(14.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BNP Antibody Summary

Immunogen
NPPB (NP_002512.1, 1 a.a. - 134 a.a.) full-length human protein. MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Specificity
NPPB - natriuretic peptide precursor B,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPPB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB and recombinant protein with GST tag for ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BNP Antibody

  • BNF
  • BNP
  • brain type natriuretic peptide
  • Gamma-brain natriuretic peptide
  • natriuretic peptide B
  • natriuretic peptide precursor B
  • natriuretic peptides B
  • natriuretic protein
  • NPPB

Background

BNP (Brain natriuretic peptide) is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. BNP is a 32 amino acid polypeptide and is co-secreted along with a 76 amino acid N-terminal fragment which is biologically inactive. This protein has biological actions including natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Recombinant human BNP, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00004879-D01P
Species: Hu
Applications: WB

Publications for BNP Antibody (H00004879-D01P) (0)

There are no publications for BNP Antibody (H00004879-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNP Antibody (H00004879-D01P) (0)

There are no reviews for BNP Antibody (H00004879-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BNP Antibody (H00004879-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNP Products

Bioinformatics Tool for BNP Antibody (H00004879-D01P)

Discover related pathways, diseases and genes to BNP Antibody (H00004879-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BNP Antibody (H00004879-D01P)

Discover more about diseases related to BNP Antibody (H00004879-D01P).
 

Pathways for BNP Antibody (H00004879-D01P)

View related products by pathway.

PTMs for BNP Antibody (H00004879-D01P)

Learn more about PTMs related to BNP Antibody (H00004879-D01P).
 

Research Areas for BNP Antibody (H00004879-D01P)

Find related products by research area.

Blogs on BNP

There are no specific blogs for BNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPPB
Entrez
Uniprot