BNIP1 Antibody - Azide and BSA Free

Western Blot: BNIP1 Antibody [H00000662-B01P] - Analysis of BNIP1 expression in human pancreas.

Western Blot: BNIP1 Antibody [H00000662-B01P] - Analysis of BNIP1 expression in transfected 293T cell line by BNIP1 polyclonal antibody. Lane1:BNIP1 transfected lysate(25.19 KDa). Lane 2:Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BNIP1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: BNIP1 (AAH10959, 1 a.a. - 228 a.a.) full-length human protein. MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
• Specificity: BNIP1 - BCL2/adenovirus E1B 19kDa interacting protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: BNIP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BNIP1 Antibody - Azide and BSA Free

• BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
• BCL2/adenovirus E1B 19kDa interacting protein 1
• BCL2/adenovirus E1B 19kD-interacting protein 1
• Nip1
• SEC20
• SEC20L
• Transformation-related gene 8 protein
• TRG-8
• vesicle transport protein SEC20

Background

This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. Alternative splicing of this gene results in four protein products with identical N- and C-termini. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BNIP1
• Entrez:
  • 662(Human)
• Uniprot:
  • AAH10959(Human)