BMP2K Antibody


Western Blot: BMP2K Antibody [NBP1-52902] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

BMP2K Antibody Summary

Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the middle region of BMP2K. Peptide sequence VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BMP2K and was validated on Western blot.
Positive Control
BMP2K Lysate (NBP2-64678)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BMP2K Antibody

  • BIKe
  • BMP2 inducible kinase
  • BMP-2-inducible protein kinase
  • DKFZp434K0614
  • DKFZp434P0116
  • EC


BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
Species: Hu
Species: Hu
Applications: WB, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, Neut
Species: Hu
Applications: WB, IHC, Neut

Publications for BMP2K Antibody (NBP1-52902) (0)

There are no publications for BMP2K Antibody (NBP1-52902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP2K Antibody (NBP1-52902) (0)

There are no reviews for BMP2K Antibody (NBP1-52902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BMP2K Antibody (NBP1-52902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional BMP2K Products

Bioinformatics Tool for BMP2K Antibody (NBP1-52902)

Discover related pathways, diseases and genes to BMP2K Antibody (NBP1-52902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP2K Antibody (NBP1-52902)

Discover more about diseases related to BMP2K Antibody (NBP1-52902).

Pathways for BMP2K Antibody (NBP1-52902)

View related products by pathway.

Research Areas for BMP2K Antibody (NBP1-52902)

Find related products by research area.

Blogs on BMP2K

There are no specific blogs for BMP2K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BMP2K Antibody and receive a gift card or discount.


Gene Symbol BMP2K