BMP-5 Antibody (3G11)

Images

 
Sandwich ELISA: BMP-5 Antibody (3G11) [H00000653-M03] - Detection limit for recombinant GST tagged BMP5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BMP-5 Antibody (3G11) Summary

Immunogen
BMP5 (NP_066551.1 341 a.a. - 440 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Specificity
BMP5 (3G11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BMP5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BMP-5 Antibody (3G11)

  • BMP5
  • BMP-5
  • bone morphogenetic protein 5
  • MGC34244

Background

This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
113-BP/CF
Species: Hu
AF853
Species: Mu
Applications: WB, IHC
1073-BP/CF
Species: Hu
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-45808
Species: Hu
Applications: IHC
MAB6937
Species: Hu
Applications: WB
NB100-56656
Species: Hu, Mu, Rt
Applications: WB

Publications for BMP-5 Antibody (H00000653-M03) (0)

There are no publications for BMP-5 Antibody (H00000653-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-5 Antibody (H00000653-M03) (0)

There are no reviews for BMP-5 Antibody (H00000653-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BMP-5 Antibody (H00000653-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BMP-5 Products

Bioinformatics Tool for BMP-5 Antibody (H00000653-M03)

Discover related pathways, diseases and genes to BMP-5 Antibody (H00000653-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMP-5 Antibody (H00000653-M03)

Discover more about diseases related to BMP-5 Antibody (H00000653-M03).
 

Pathways for BMP-5 Antibody (H00000653-M03)

View related products by pathway.

PTMs for BMP-5 Antibody (H00000653-M03)

Learn more about PTMs related to BMP-5 Antibody (H00000653-M03).
 

Research Areas for BMP-5 Antibody (H00000653-M03)

Find related products by research area.

Blogs on BMP-5

There are no specific blogs for BMP-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMP-5 Antibody (3G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP5
Entrez
OMIM
Uniprot