BMAL1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BMAL1 Antibody [NBP2-56754] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BMAL1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
Specificity
Specificity of human BMAL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
BMAL1 Knockout HeLa Cell Lysate
Control Peptide
BMAL1 Recombinant Protein Antigen (NBP2-56754PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for BMAL1 Antibody

  • ARNTL
  • aryl hydrocarbon receptor nuclear translocator-like protein 1
  • aryl hydrocarbon receptor nuclear translocator-like
  • basic-helix-loop-helix-PAS orphan MOP3
  • BHLHE5
  • bHLHe5brain and muscle
  • bHLH-PAS protein JAP3
  • BMAL1
  • BMAL1c
  • BMAL1TIC
  • Brain and muscle ARNT-like 1
  • Class E basic helix-loop-helix protein 5
  • JAP3
  • Member of PAS protein 3
  • member of PAS superfamily 3
  • MOP3
  • MOP3BMAL1c
  • PAS domain-containing protein 3
  • PASD3
  • PASD3MGC47515
  • TIC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24589
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IB, IHC, IHC-P, KO
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
21670002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-69080
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-76914
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt, Eq
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP1-31363
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009572-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NB100-1800
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ChIP, CHIP-SEQ
NBP2-56754
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for BMAL1 Antibody (NBP2-56754) (0)

There are no publications for BMAL1 Antibody (NBP2-56754).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMAL1 Antibody (NBP2-56754) (0)

There are no reviews for BMAL1 Antibody (NBP2-56754). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BMAL1 Antibody (NBP2-56754) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BMAL1 Products

Bioinformatics Tool for BMAL1 Antibody (NBP2-56754)

Discover related pathways, diseases and genes to BMAL1 Antibody (NBP2-56754). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BMAL1 Antibody (NBP2-56754)

Discover more about diseases related to BMAL1 Antibody (NBP2-56754).
 

Pathways for BMAL1 Antibody (NBP2-56754)

View related products by pathway.

PTMs for BMAL1 Antibody (NBP2-56754)

Learn more about PTMs related to BMAL1 Antibody (NBP2-56754).
 

Research Areas for BMAL1 Antibody (NBP2-56754)

Find related products by research area.

Blogs on BMAL1

There are no specific blogs for BMAL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BMAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNTL