BMAL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: BMAL1 Antibody [NBP2-56754] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BMAL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BMAL1 Antibody - BSA Free (NBP2-56754) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BMAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BMAL1 Recombinant Protein Antigen (NBP2-56754PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BMAL1 Antibody - BSA Free

• ARNTL
• aryl hydrocarbon receptor nuclear translocator-like protein 1
• aryl hydrocarbon receptor nuclear translocator-like
• basic-helix-loop-helix-PAS orphan MOP3
• BHLHE5
• bHLHe5brain and muscle
• bHLH-PAS protein JAP3
• BMAL1
• BMAL1c
• BMAL1TIC
• Brain and muscle ARNT-like 1
• Class E basic helix-loop-helix protein 5
• JAP3
• Member of PAS protein 3
• member of PAS superfamily 3
• MOP3
• MOP3BMAL1c
• PAS domain-containing protein 3
• PASD3
• PASD3MGC47515
• TIC

Background

Aryl hydrocarbon receptor nuclear translocator-like (ARNTL), also known as Bmal1 or Mop3 is a major component of the circadian clock oscillator. Specifically, BMAL-1 acts as a general dimerization partner for a subset of the bHLH-PAS (basic-helix-loop-helix-PER-ARNT-SIM) superfamily of transcription regulators, is involved in circadian rhythm generation. BMAL 1 interacts with MOP4, CLOCK, Hypoxia-inducible factor-1 alpha and -2 alpha. This interaction appears to be distinct from that of the more characterized general partner, ARNT (HIF-1Beta).

BMAL1 is highly expressed in the adult brain, skeletal muscle and heart, and has been associated with hypertension and type 2 diabetes. Because of its role in the circadian clock oscillator, BMAL-1 is also thought to be invloven seasonal affective disorder. Therefore, BMAL1 antibodies are useful for circadian studies as well as heart and brain research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BMAL1