Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, RbSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Rabbit (100%), Bovine (92%), Guinea Pig (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | FUT1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | This is a rabbit polyclonal antibody against FUT1 and was validated on Western blot. |
Theoretical MW | 41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Blood group H inhibitor Antibody (NBP1-57016)Discover more about diseases related to Blood group H inhibitor Antibody (NBP1-57016).
| Pathways for Blood group H inhibitor Antibody (NBP1-57016)View related products by pathway.
|
PTMs for Blood group H inhibitor Antibody (NBP1-57016)Learn more about PTMs related to Blood group H inhibitor Antibody (NBP1-57016).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.