Home » Blood group H inhibitor » Blood group H inhibitor Antibodies » Blood group H inhibitor Antibody

Blood group H inhibitor Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Blood group H inhibitor Antibody Summary

Immunogen
Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Goat (100%), Equine (100%), Rabbit (100%), Bovine (92%), Guinea Pig (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FUT1 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Blood group H inhibitor Antibody

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase
  • Blood group H alpha 2-fucosyltransferase
  • EC 2.4.1.69
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Fucosyltransferase 1
  • galactoside 2-alpha-L-fucosyltransferase 1
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
  • HHH
  • HSC

Background

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(5 Reviews)
(36 Publications)
Species: Hu
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - Analysis of a FFPE tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
(20 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
GLI-1 Antibody
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Staining in canine hair follicle. Image from a verified customer review.
Flow (Intracellular): GLI-1 Antibody [NB600-600] - Staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - Analysis of a FFPE mouse brain section using GLI-1 antibody at 1:600 dilution.
(1 Review)
(33 Publications)
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC, KD
Patched 1/PTCH
Antibody
NBP1-71662
Western Blot: Patched 1/PTCH Antibody [NBP1-71662] - Analysis of Patched 1 in human skeletal muscle protein.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody [NBP1-71662] - IHC analysis of formalin fixed paraffin embedded tissue section of mouse lung using 1:50 dilution of PTCH antibody with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a specific membrane-cytoplasmic staining in bronchiolar and alveolar epithelial cells with stronger signal towards the membranes of the cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Smoothened Antibody
NLS2666
Immunohistochemistry-Paraffin: Smoothened Antibody [NLS2666] - Analysis of anti-Smoothened antibody with human kidney.
(1 Publication)
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Analysis in human cell line A-549 and human cell line MCF-7
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles. Antibody staining is shown in green.
Species: Hu
Applications: WB, ICC/IF
Smoothened Antibody
NLS2666
Immunohistochemistry-Paraffin: Smoothened Antibody [NLS2666] - Analysis of anti-Smoothened antibody with human kidney.
(1 Publication)
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Pm, Rb
Applications: ICC/IF, IHC, IHC-P
SCF/c-kit Ligand
[Unconjugated]
7466-SC/CF
SCF/c-kit Ligand [Unconjugated]
(3 Publications)
Species: Hu
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Immunohistochemistry-Paraffin: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Formalin-fixed, paraffin-embedded human Tonsil stained with HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
Flow (Intracellular): NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on THP-1 cells with NOD2 (2D9) antibody NB100-524AF488 (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
CD117/c-kit
Antibody [Unconjugate
AF1356
Western blot shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line, and MC/9‑2 mouse mast cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for CD117/c-kit at approximately 135, 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit was detected in immersion fixed frozen sections of mouse embryo using Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(10 Reviews)
(29 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(31 Reviews)
(645 Publications)
Species: Hu
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
Indian
Hedgehog/Ihh [Unconju
1705-HH/CF
Indian Hedgehog/Ihh [Unconjugated]
(6 Publications)
Species: Hu, Mu
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Factor IX Antibody
NBP1-33581
Immunocytochemistry/Immunofluorescence: Factor IX Antibody [NBP1-33581] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Factor IX protein stained by Factor IX antibody [N3C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Mouse liver. Factor IX stained by Factor IX antibody [N3C3] diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Paraffin-embedded human colon cancer. Factor IX antibody [N3C3] diluted at 1:250.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Blood group H inhibitor Antibody (NBP1-57016) (0)

There are no publications for Blood group H inhibitor Antibody (NBP1-57016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blood group H inhibitor Antibody (NBP1-57016) (0)

There are no reviews for Blood group H inhibitor Antibody (NBP1-57016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blood group H inhibitor Antibody (NBP1-57016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Blood group H inhibitor Products

Bioinformatics Tool for Blood group H inhibitor Antibody (NBP1-57016)

Discover related pathways, diseases and genes to Blood group H inhibitor Antibody (NBP1-57016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blood group H inhibitor Antibody (NBP1-57016)

Discover more about diseases related to Blood group H inhibitor Antibody (NBP1-57016).
 

Pathways for Blood group H inhibitor Antibody (NBP1-57016)

View related products by pathway.

PTMs for Blood group H inhibitor Antibody (NBP1-57016)

Learn more about PTMs related to Blood group H inhibitor Antibody (NBP1-57016).

Blogs on Blood group H inhibitor

There are no specific blogs for Blood group H inhibitor, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Blood group H inhibitor Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FUT1
Entrez
Uniprot