Blood group H inhibitor Antibody

Images

 
Western Blot: Blood group H inhibitor Antibody [H00002523-B01P] - Analysis of FUT1 expression in transfected 293T cell line by FUT1 polyclonal antibody. Lane 1: FUT1 transfected lysate(40.15 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Blood group H inhibitor Antibody Summary

Immunogen
FUT1 (NP_000139.1, 1 a.a. - 365 a.a.) full-length human protein. MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FUT1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blood group H inhibitor Antibody

  • alpha (1,2) fucosyltransferase
  • Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase
  • Blood group H alpha 2-fucosyltransferase
  • EC 2.4.1.69
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included)
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Fucosyltransferase 1
  • galactoside 2-alpha-L-fucosyltransferase 1
  • GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
  • HHH
  • HSC

Background

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
1705-HH/CF
Species: Hu, Mu
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00002523-B01P
Species: Hu
Applications: WB

Publications for Blood group H inhibitor Antibody (H00002523-B01P) (0)

There are no publications for Blood group H inhibitor Antibody (H00002523-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blood group H inhibitor Antibody (H00002523-B01P) (0)

There are no reviews for Blood group H inhibitor Antibody (H00002523-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blood group H inhibitor Antibody (H00002523-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Blood group H inhibitor Products

Bioinformatics Tool for Blood group H inhibitor Antibody (H00002523-B01P)

Discover related pathways, diseases and genes to Blood group H inhibitor Antibody (H00002523-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blood group H inhibitor Antibody (H00002523-B01P)

Discover more about diseases related to Blood group H inhibitor Antibody (H00002523-B01P).
 

Pathways for Blood group H inhibitor Antibody (H00002523-B01P)

View related products by pathway.

PTMs for Blood group H inhibitor Antibody (H00002523-B01P)

Learn more about PTMs related to Blood group H inhibitor Antibody (H00002523-B01P).

Blogs on Blood group H inhibitor

There are no specific blogs for Blood group H inhibitor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Blood group H inhibitor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT1
Uniprot