We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

BLMH/Bleomycin Hydrolase Recombinant Protein Antigen

Images

 
There are currently no images for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BLMH/Bleomycin Hydrolase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLMH.

Source: E. coli

Amino Acid Sequence: RKEPEDGRLVQFLLMNPANDGGQWDMLVNIVEKYGVIPKKCFPESYTTEATRRMNDILNHKMREFCIRLRNLVHSGATKGEISATQDVMMEEIFRVVCICLGNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BLMH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BLMH/Bleomycin Hydrolase Recombinant Protein Antigen

  • BHBMHBLM hydrolase
  • bleomycin hydrolase
  • BLMH
  • BMH
  • EC 3.4.22.40

Background

Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80917
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-84949
Species: Hu
Applications: IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-03256
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-88640PEP
Species: Hu
Applications: AC

Publications for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP) (0)

There are no publications for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP) (0)

There are no reviews for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLMH/Bleomycin Hydrolase Products

Research Areas for BLMH/Bleomycin Hydrolase Protein (NBP1-88640PEP)

Find related products by research area.

Blogs on BLMH/Bleomycin Hydrolase

There are no specific blogs for BLMH/Bleomycin Hydrolase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BLMH/Bleomycin Hydrolase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BLMH