![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining in human bone marrow and pancreas tissues using anti-BIN2 antibody. Corresponding BIN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0005.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining in human bone marrow and pancreas tissues using anti-BIN2 antibody. Corresponding BIN2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKPVRTPEAKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISADSSEGQDQLQVSMVPENNNLTAPEPQEEVSTSENPQL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BIN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BIN2 Antibody (NBP2-48690)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BIN2 |
![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow, liver, lymph node and pancreas using Anti-BIN2 antibody NBP2-48690 (A) shows similar protein distribution across tissues to independent antibody NBP2-48691 (B).](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0006.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow, liver, lymph node and pancreas using Anti-BIN2 antibody NBP2-48690 (A) shows similar protein distribution across tissues to independent antibody NBP2-48691 (B).")
![Western Blot: BIN2 Antibody [NBP2-48690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/BIN2-Antibody-Western-Blot-NBP2-48690-img0002.jpg "Western Blot: BIN2 Antibody [NBP2-48690] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human liver.](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0008.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human liver.")
![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow shows high expression.](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0003.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human bone marrow shows high expression.")
![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0004.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human lymph node.](http://images.novusbio.com/fullsize/BIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-48690-img0007.jpg "Immunohistochemistry-Paraffin: BIN2 Antibody [NBP2-48690] - Staining of human lymph node.")
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![FXR/NR1H4 Antibody (A9033A) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FXR/NR1H4 Antibody (A9033A) [Unconjugated]")
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Immunohistochemistry_6669.jpg)
![Western Blot PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_beta_AF1042_Western_Blot_17545.jpg)
![Immunohistochemistry PDGF R beta Antibody [Unconjugated]](https://images.novusbio.com/images/af1042_mouse-pdgf-r-beta-affinity-purified-polyclonal-ab-41202410481131.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")