PPP1R11 Antibody

Images

 
Immunohistochemistry-Paraffin: PPP1R11 Antibody [NBP2-13798] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP1R11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGR RSSKCCCIYEKPRAFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPP1R11 Protein (NBP2-13798PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP1R11 Antibody

  • HCG V
  • HCG-V
  • inhibitor-3
  • IPP3
  • protein phosphatase 1 regulatory subunit 11
  • protein phosphatase 1, regulatory (inhibitor) subunit 11
  • TCTE5
  • TCTEX5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-46090
Species: Hu
Applications: WB, IHC
NBP2-05096
Species: Hu
NBP2-58497
Species: Hu
Applications: WB, ICC/IF
NBP1-47924
Species: Hu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57698
Species: Hu
Applications: WB
AF1747
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP

Publications for PPP1R11 Antibody (NBP2-13798) (0)

There are no publications for PPP1R11 Antibody (NBP2-13798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R11 Antibody (NBP2-13798) (0)

There are no reviews for PPP1R11 Antibody (NBP2-13798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PPP1R11 Antibody (NBP2-13798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP1R11 Products

Bioinformatics Tool for PPP1R11 Antibody (NBP2-13798)

Discover related pathways, diseases and genes to PPP1R11 Antibody (NBP2-13798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R11 Antibody (NBP2-13798)

Discover more about diseases related to PPP1R11 Antibody (NBP2-13798).
 

Pathways for PPP1R11 Antibody (NBP2-13798)

View related products by pathway.

PTMs for PPP1R11 Antibody (NBP2-13798)

Learn more about PTMs related to PPP1R11 Antibody (NBP2-13798).

Blogs on PPP1R11

There are no specific blogs for PPP1R11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP1R11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R11