BIN1 Recombinant Protein Antigen

Images

 
There are currently no images for BIN1 Protein (NBP1-89103PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BIN1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BIN1.

Source: E. coli

Amino Acid Sequence: VTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89103.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BIN1 Recombinant Protein Antigen

  • AMPH2
  • Amphiphysin II
  • Amphiphysin-like protein
  • AMPHLDKFZp547F068
  • box dependant MYC interacting protein 1
  • bridging integrator 1Box-dependent myc-interacting protein 1
  • MGC10367
  • myc box-dependent-interacting protein 1
  • SH3P9

Background

BIN1 encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-47477
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86033
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB300-949
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-56094
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-67187
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, IP, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-05645
Species: Hu
Applications: WB
NBP1-90625
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB400-163
Species: Mu
Applications: Flow, IHC,  IHC-P, WB
NB300-543
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-89103PEP
Species: Hu
Applications: AC

Publications for BIN1 Protein (NBP1-89103PEP) (0)

There are no publications for BIN1 Protein (NBP1-89103PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIN1 Protein (NBP1-89103PEP) (0)

There are no reviews for BIN1 Protein (NBP1-89103PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BIN1 Protein (NBP1-89103PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BIN1 Products

Research Areas for BIN1 Protein (NBP1-89103PEP)

Find related products by research area.

Blogs on BIN1

There are no specific blogs for BIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BIN1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BIN1