BIN1 Antibody (2C7)

Images

 
Western Blot: BIN1 Antibody (2C7) [H00000274-M03] - Analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody (M03), clone 2C7. Lane 1: BIN1 transfected lysatE (53 KDa). Lane 2: ...read more
Sandwich ELISA: BIN1 Antibody (2C7) [H00000274-M03] - Detection limit for recombinant GST tagged BIN1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BIN1 Antibody (2C7) Summary

Immunogen
BIN1 (NP_004296 355 a.a. - 454 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Specificity
BIN1 - bridging integrator 1 (2C7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BIN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BIN1 Antibody (2C7)

  • AMPH2
  • Amphiphysin II
  • Amphiphysin-like protein
  • AMPHLDKFZp547F068
  • box dependant MYC interacting protein 1
  • bridging integrator 1Box-dependent myc-interacting protein 1
  • MGC10367
  • myc box-dependent-interacting protein 1
  • SH3P9

Background

This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56690
Species: Hu
Applications: ICC/IF
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
H00000274-M03
Species: Hu
Applications: WB, ELISA

Publications for BIN1 Antibody (H00000274-M03) (0)

There are no publications for BIN1 Antibody (H00000274-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BIN1 Antibody (H00000274-M03) (0)

There are no reviews for BIN1 Antibody (H00000274-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BIN1 Antibody (H00000274-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BIN1 Products

Bioinformatics Tool for BIN1 Antibody (H00000274-M03)

Discover related pathways, diseases and genes to BIN1 Antibody (H00000274-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIN1 Antibody (H00000274-M03)

Discover more about diseases related to BIN1 Antibody (H00000274-M03).
 

Pathways for BIN1 Antibody (H00000274-M03)

View related products by pathway.

PTMs for BIN1 Antibody (H00000274-M03)

Learn more about PTMs related to BIN1 Antibody (H00000274-M03).
 

Research Areas for BIN1 Antibody (H00000274-M03)

Find related products by research area.

Blogs on BIN1

There are no specific blogs for BIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIN1 Antibody (2C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol BIN1
Entrez
Uniprot