Betacellulin/BTC Antibody

Images

 
Western Blot: Betacellulin/BTC Antibody [H00000685-D01P] - Analysis of BTC expression in transfected 293T cell line by BTC polyclonal antibody.Lane 1: BTC transfected lysate(19.70 KDa).Lane 2: Non-transfected lysate.
Proximity Ligation Assay: Betacellulin/BTC Antibody [H00000685-D01P] - Analysis of protein-protein interactions between BTC and ERBB2. HeLa cells were stained with anti-BTC rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Betacellulin/BTC Antibody Summary

Immunogen
BTC (NP_001720.1, 1 a.a. - 178 a.a.) full-length human protein. MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Specificity
BTC - betacellulin,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Betacellulin/BTC Antibody

  • Betacellulin
  • BTC
  • probetacellulin

Background

The protein encoded by this gene is a member of the EGF family of growth factors. It is synthesized primarily as a transmembrane precursor, which is then processed to mature molecule by proteolytic events. This protein is a ligand for the EGF receptor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
AF1195
Species: Hu
Applications: WB, IHC, Neut
259-HE
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00000685-D01P
Species: Hu
Applications: WB, PLA

Publications for Betacellulin/BTC Antibody (H00000685-D01P) (0)

There are no publications for Betacellulin/BTC Antibody (H00000685-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Betacellulin/BTC Antibody (H00000685-D01P) (0)

There are no reviews for Betacellulin/BTC Antibody (H00000685-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Betacellulin/BTC Antibody (H00000685-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Betacellulin/BTC Products

Bioinformatics Tool for Betacellulin/BTC Antibody (H00000685-D01P)

Discover related pathways, diseases and genes to Betacellulin/BTC Antibody (H00000685-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Betacellulin/BTC Antibody (H00000685-D01P)

Discover more about diseases related to Betacellulin/BTC Antibody (H00000685-D01P).
 

Pathways for Betacellulin/BTC Antibody (H00000685-D01P)

View related products by pathway.

PTMs for Betacellulin/BTC Antibody (H00000685-D01P)

Learn more about PTMs related to Betacellulin/BTC Antibody (H00000685-D01P).
 

Research Areas for Betacellulin/BTC Antibody (H00000685-D01P)

Find related products by research area.

Blogs on Betacellulin/BTC

There are no specific blogs for Betacellulin/BTC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Betacellulin/BTC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTC
Entrez
Uniprot