beta ureidopropionase Antibody

Images

 
Western Blot: beta ureidopropionase Antibody [NBP1-54347] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta ureidopropionase Antibody Summary

Immunogen
Synthetic peptides corresponding to UPB1(ureidopropionase, beta) The peptide sequence was selected from the middle region of UPB1. Peptide sequence NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UPB1 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for beta ureidopropionase Antibody

  • Beta-alanine synthase
  • beta-ureidopropionase
  • BUP-1
  • BUP1EC 3.5.1.6
  • N-carbamoyl-beta-alanine amidohydrolase
  • ureidopropionase, beta

Background

UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85224
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-84916
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008706-P01
Species: Hu
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54347
Species: Hu
Applications: WB

Publications for beta ureidopropionase Antibody (NBP1-54347) (0)

There are no publications for beta ureidopropionase Antibody (NBP1-54347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta ureidopropionase Antibody (NBP1-54347) (0)

There are no reviews for beta ureidopropionase Antibody (NBP1-54347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta ureidopropionase Antibody (NBP1-54347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for beta ureidopropionase Antibody (NBP1-54347)

Discover related pathways, diseases and genes to beta ureidopropionase Antibody (NBP1-54347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta ureidopropionase Antibody (NBP1-54347)

Discover more about diseases related to beta ureidopropionase Antibody (NBP1-54347).
 

Pathways for beta ureidopropionase Antibody (NBP1-54347)

View related products by pathway.

PTMs for beta ureidopropionase Antibody (NBP1-54347)

Learn more about PTMs related to beta ureidopropionase Antibody (NBP1-54347).

Blogs on beta ureidopropionase

There are no specific blogs for beta ureidopropionase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta ureidopropionase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UPB1
Uniprot