We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human beta II Tubulin A GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human beta II Tubulin A Protein [H00007280-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human beta II Tubulin A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-445 of Human TUBB2A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TUBB2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
74.47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human beta II Tubulin A GST (N-Term) Protein

  • beta II Tubulin A
  • dJ40E16.7
  • TUBB
  • TUBB2
  • TUBB2A
  • TUBB2B
  • tubulin beta-2A chain
  • tubulin, beta 2
  • tubulin, beta 2A
  • tubulin, beta polypeptide 2
  • tubulin, beta polypeptide

Background

Tubulin is the major building block of microtubules. This intracellular cylindrical filamentous structure is present in almost all eukaryotic cells. Microtubules function as structural and mobile elements in mitosis, intracellular transport, flagellar movement, and in the cytoskeleton.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1195
Species: All-Multi
Applications: ICC, IHC, ICFlow, Simple Western, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB100-64792
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-71830
Species: Hu
Applications: IP, WB
MAB9036
Species: Hu
Applications: ICC, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, mIF, Simple Western, WB
NBP2-46245
Species: Ca, Hu, Pm, Mu, Rt
Applications: COMET, ICC/IF, IHC,  IHC-P, mIF, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-00812
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-41568
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
291-G1
Species: Hu
Applications: BA
NBP2-14886
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13250
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91931
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-25147
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: IA, ICC/IF, IHC, Simple Western, WB

Publications for beta II Tubulin A Recombinant Protein (H00007280-P01) (0)

There are no publications for beta II Tubulin A Recombinant Protein (H00007280-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta II Tubulin A Recombinant Protein (H00007280-P01) (0)

There are no reviews for beta II Tubulin A Recombinant Protein (H00007280-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for beta II Tubulin A Recombinant Protein (H00007280-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional beta II Tubulin A Products

Research Areas for beta II Tubulin A Recombinant Protein (H00007280-P01)

Find related products by research area.

Blogs on beta II Tubulin A

There are no specific blogs for beta II Tubulin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human beta II Tubulin A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TUBB2A