beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

Western Blot: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01] - Analysis of DEFB4 expression in transfected 293T cell line by DEFB4 monoclonal antibody (M01), clone 4C4.Lane 1: DEFB4 transfected lysate(7.038 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: beta-Defensin 4/2 Antibody (4C4) [H00001673-M01] - Detection limit for recombinant GST tagged DEFB4 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DEFB4 (NP_004933, 24 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
• Specificity: DEFB4 (4C4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DEFB4A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for beta-Defensin 4/2 Antibody (4C4) - Azide and BSA Free

• BD-2
• betaDefensin 2
• beta-Defensin 2
• DEFB2
• DEFB-2
• DEFB2DEFB102
• DEFB4A
• DEFB4B
• DEFB4beta-defensin 4A
• Defensin, beta 2Skin-antimicrobial peptide 1
• defensin, beta 4
• defensin, beta 4A
• HBD-2
• SAP-1
• SAP1BD-2

Background

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DEFB4A
• Entrez:
  • 1673(Human)
• OMIM:
  • 602215(Human)
• Uniprot:
  • NP_004933(Human)