BCL9-2 Antibody

Images

 
Western Blot: BCL9-2 Antibody [NBP2-14350] - Analysis in human cell lines A-549 and HEK293 using Anti-BCL9L antibody. Corresponding BCL9L RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/ Immunofluorescence: BCL9-2 Antibody [NBP2-14350] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BCL9-2 Antibody [NBP2-14350] - Staining of human breast shows moderate nuclear positivity in glandular cells.
Western Blot: BCL9-2 Antibody [NBP2-14350] - Analysis in human cell line CACO-2.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

BCL9-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSMCHPGQMSLLGRTGVPPQQGMVPHGLHQGVMSPPQGLMTQQNFMLMKQ RGVGGEVYSQPPHMLSPQGSLMGPPPQQNLMVSHPLRQRSVSLDSQMGYL PAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCL9L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
BCL9-2 Protein (NBP2-14350PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCL9-2 Antibody

  • B-cell CLL/lymphoma 9-like protein
  • B-cell CLL/lymphoma 9-like
  • B-cell lymphoma 9-like protein
  • Bcl92
  • Bcl9-2
  • BCL9-like protein
  • DLNB11
  • DLNB11BCL9-2
  • nuclear co-factor of beta-catenin signalling
  • Protein BCL9-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3996
Species: Hu
Applications: WB
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-10820
Species: Hu
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
AF4885
Species: Mu
Applications: WB, IP
MAB190
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
MAB3617
Species: Hu, Mu
Applications: WB
NBP2-14401
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90450
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF3445
Species: Mu
Applications: WB, IHC
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BCL9-2 Antibody (NBP2-14350) (0)

There are no publications for BCL9-2 Antibody (NBP2-14350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL9-2 Antibody (NBP2-14350) (0)

There are no reviews for BCL9-2 Antibody (NBP2-14350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BCL9-2 Antibody (NBP2-14350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCL9-2 Products

Bioinformatics Tool for BCL9-2 Antibody (NBP2-14350)

Discover related pathways, diseases and genes to BCL9-2 Antibody (NBP2-14350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCL9-2 Antibody (NBP2-14350)

Discover more about diseases related to BCL9-2 Antibody (NBP2-14350).
 

Pathways for BCL9-2 Antibody (NBP2-14350)

View related products by pathway.

PTMs for BCL9-2 Antibody (NBP2-14350)

Learn more about PTMs related to BCL9-2 Antibody (NBP2-14350).

Blogs on BCL9-2

There are no specific blogs for BCL9-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL9-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL9L
Entrez