BCL7C Antibody (5F1)

Images

 
Sandwich ELISA: BCL7C Antibody (5F1) [H00009274-M01] - Detection limit for recombinant GST tagged BCL7C is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BCL7C Antibody (5F1) Summary

Immunogen
BCL7C (NP_004756, 86 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
Specificity
BCL7C - B-cell CLL/lymphoma 7C
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BCL7C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL7C Antibody (5F1)

  • B-cell CLL/lymphoma 7 protein family member C
  • B-cell CLL/lymphoma 7C

Background

This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BCL7C Antibody (H00009274-M01) (0)

There are no publications for BCL7C Antibody (H00009274-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL7C Antibody (H00009274-M01) (0)

There are no reviews for BCL7C Antibody (H00009274-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL7C Antibody (H00009274-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCL7C Antibody (5F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL7C
Entrez
OMIM
Uniprot