BCL7C Antibody (1A4) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: BCL7C Antibody (1A4) [H00009274-M02] - Analysis of monoclonal antibody to BCL7C on HeLa cell . Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BCL7C Antibody (1A4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse BCL7C Antibody (1A4) - Azide and BSA Free (H00009274-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: BCL7C (NP_004756, 86 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: BCL7C
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL7C Antibody (1A4) - Azide and BSA Free

• B-cell CLL/lymphoma 7 protein family member C
• B-cell CLL/lymphoma 7C

Background

This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL7C
• Uniprot:
  • NP_004756(Human)