Bcl3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl3. Source: E. coli Amino Acid Sequence: AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
BCL3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57127. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Bcl3 Recombinant Protein Antigen
Background
The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.
Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu
Applications: Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP) (0)
There are no publications for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP) (0)
There are no reviews for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP) (0)
Additional Bcl3 Products
Research Areas for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP)
Find related products by research area.
|
Blogs on Bcl3