BCAS2 Antibody - BSA Free

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: BCAS2 Antibody [NBP3-38090] - Western blot analysis of various lysates using BCAS2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: BCAS2 Antibody [NBP3-38090] - Confocal immunofluorescence analysis of U2OS cells using BCAS2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: BCAS2 Antibody [NBP3-38090] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using BCAS2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCAS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCAS2 Antibody - BSA Free (NBP3-38090) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human BCAS2 (NP_005863.1).
  
  Sequence:
  MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BCAS2 Antibody - BSA Free

• breast carcinoma amplified sequence 2
• Breast carcinoma-amplified sequence 2
• DAM1DNA amplified in mammary carcinoma 1 protein
• pre-mRNA-splicing factor SPF27
• Snt309
• SPF27
• spliceosome associated protein, amplified in breast cancer
• Spliceosome-associated protein SPF 27

Background

BCAS2 is a Ubiquitously expressed nuclear protein associated with the splicesome. The deduced 225-amino acid protein contains a central potential N-glycosylation site and multiple N-terminal potential phosphorylation sites. Northern and Southern blot analyses demonstrates expression of a 1.5-kb transcript at various levels in multiple breast cancer cell lines, with greatest amplification in BT-20 and MCF-7 cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAS2