BCAS2 Antibody - BSA Free

Western Blot: BCAS2 Antibody [NBP2-49532] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG

Immunocytochemistry/Immunofluorescence: BCAS2 Antibody [NBP2-49532] - Staining of human cell line U-2 OS shows localization to nuclear speckles & centrosome.

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining in human thyroid gland and pancreas tissues using anti-BCAS2 antibody. Corresponding BCAS2 RNA-seq data are presented for the same tissues.

Immunohistochemistry: BCAS2 Antibody [NBP2-49532] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BCAS2 Antibody [NBP2-49532] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCAS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCAS2 Antibody - BSA Free (NBP2-49532) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BCAS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BCAS2 Recombinant Protein Antigen (NBP2-49532PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BCAS2 Antibody - BSA Free

• breast carcinoma amplified sequence 2
• Breast carcinoma-amplified sequence 2
• DAM1DNA amplified in mammary carcinoma 1 protein
• pre-mRNA-splicing factor SPF27
• Snt309
• SPF27
• spliceosome associated protein, amplified in breast cancer
• Spliceosome-associated protein SPF 27

Background

BCAS2 is a Ubiquitously expressed nuclear protein associated with the splicesome. The deduced 225-amino acid protein contains a central potential N-glycosylation site and multiple N-terminal potential phosphorylation sites. Northern and Southern blot analyses demonstrates expression of a 1.5-kb transcript at various levels in multiple breast cancer cell lines, with greatest amplification in BT-20 and MCF-7 cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAS2