BCAP/PIK3AP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BCAP/PIK3AP1 Antibody [NBP2-38413] - Staining in human spleen and skeletal muscle tissues using anti-PIK3AP1 antibody. Corresponding PIK3AP1 RNA-seq data are presented for the same tissues.

Western Blot: BCAP/PIK3AP1 Antibody [NBP2-38413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: BCAP/PIK3AP1 Antibody [NBP2-38413] - Staining of human cell line RH-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BCAP/PIK3AP1 Antibody [NBP2-38413] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: BCAP/PIK3AP1 Antibody [NBP2-38413] - Staining of human spleen shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BCAP/PIK3AP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BCAP/PIK3AP1 Antibody - BSA Free (NBP2-38413) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWK
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3AP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BCAP/PIK3AP1 Protein (NBP2-38413PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BCAP/PIK3AP1 Antibody - BSA Free

• 1810044J04Rik
• B cell adaptor protein
• BCAP
• BCAPB-cell adapter for phosphoinositide 3-kinase
• B-cell phosphoinositide 3-kinase adapter protein 1
• FLJ35564
• phosphoinositide 3-kinase adapter protein 1
• phosphoinositide-3-kinase adaptor protein 1
• Pik3ap1
• RP11-34E5.3

Background

PIK3AP1 is involved in the activation of phosphoinositide 3-kinase (PI3K) in B-cells and in natural killer (NK) cells.Couples B-cell antigen receptor (BCR) to PI3K activation by providing a docking site for the PI3K subunit PIK3R1,which contributes to B-cell develop

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3AP1
• Uniprot:
  • Q6ZUJ8()