BCAM/CD239 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BCAM/CD239 Antibody [NBP2-31994] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: BCAM/CD239 Antibody [NBP2-31994] - Staining of human urinary bladder shows strong membranous and cytoplasmic positivity in basal layer of urothelium.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BCAM/CD239 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BCAM/CD239 Protein (NBP2-31994PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BCAM/CD239 Antibody

  • antigen identified by monoclonal F8
  • Auberger B antigen
  • basal cell adhesion molecule (Lu and Au blood groups)
  • basal cell adhesion molecule (Lutheran blood group)
  • basal cell adhesion molecule
  • B-CAM cell surface glycoprotein
  • BCAM
  • B-cell adhesion molecule
  • CD239 antigen
  • CD239
  • F8/G253 antigen
  • glycoprotein 95kDa
  • LUAU
  • Lutheran antigen
  • Lutheran blood group (Auberger b antigen included)
  • Lutheran blood group glycoprotein
  • MSK19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2988
Species: Mu, Rt
Applications: WB
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-31994
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for BCAM/CD239 Antibody (NBP2-31994) (0)

There are no publications for BCAM/CD239 Antibody (NBP2-31994).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCAM/CD239 Antibody (NBP2-31994) (0)

There are no reviews for BCAM/CD239 Antibody (NBP2-31994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BCAM/CD239 Antibody (NBP2-31994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BCAM/CD239 Products

Bioinformatics Tool for BCAM/CD239 Antibody (NBP2-31994)

Discover related pathways, diseases and genes to BCAM/CD239 Antibody (NBP2-31994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BCAM/CD239 Antibody (NBP2-31994)

Discover more about diseases related to BCAM/CD239 Antibody (NBP2-31994).
 

Pathways for BCAM/CD239 Antibody (NBP2-31994)

View related products by pathway.

PTMs for BCAM/CD239 Antibody (NBP2-31994)

Learn more about PTMs related to BCAM/CD239 Antibody (NBP2-31994).

Blogs on BCAM/CD239

There are no specific blogs for BCAM/CD239, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BCAM/CD239 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAM
Entrez
Uniprot