Recombinant Human BBS9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BBS9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-310 of Human B1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
BBS9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BBS9 Protein

  • B1
  • Bardet-Biedl syndrome 9 protein
  • Bardet-Biedl syndrome 9
  • C18
  • D1
  • Parathyroid hormone-responsive B1 gene protein
  • protein PTHB1
  • PTHB1MGC118917
  • PTH-responsive osteosarcoma B1 protein

Background

B1( AAH32715, 1 a.a. - 311 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF1396
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00027241-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for BBS9 Recombinant Protein (H00027241-P01) (0)

There are no publications for BBS9 Recombinant Protein (H00027241-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BBS9 Recombinant Protein (H00027241-P01) (0)

There are no reviews for BBS9 Recombinant Protein (H00027241-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BBS9 Recombinant Protein (H00027241-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BBS9 Products

Bioinformatics Tool for BBS9 Recombinant Protein (H00027241-P01)

Discover related pathways, diseases and genes to BBS9 Recombinant Protein (H00027241-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BBS9 Recombinant Protein (H00027241-P01)

Discover more about diseases related to BBS9 Recombinant Protein (H00027241-P01).
 

Pathways for BBS9 Recombinant Protein (H00027241-P01)

View related products by pathway.

Research Areas for BBS9 Recombinant Protein (H00027241-P01)

Find related products by research area.

Blogs on BBS9

There are no specific blogs for BBS9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BBS9 Antibody
NBP1-88927
DIO3 Antibody
NBP1-05767

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BBS9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BBS9