BAT3/BAG6 Recombinant Protein Antigen

Images

 
There are currently no images for BAT3/BAG6 Protein (NBP2-38693PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BAT3/BAG6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAG6.

Source: E. coli

Amino Acid Sequence: SDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BAG6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38693.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BAT3/BAG6 Recombinant Protein Antigen

  • BAG6
  • BAT3
  • BAT3HLA-B associated transcript-3
  • BCL2-associated athanogene 6BAG-6
  • D6S52E
  • D6S52EHLA-B-associated transcript 3
  • G3BAG family molecular chaperone regulator 6
  • HLA-B associated transcript 3
  • large proline-rich protein BAT3
  • Protein G3
  • Protein Scythe
  • Scythe

Background

BAT3 was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-92860
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
1129-ER
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
DKK300
Species: Hu
Applications: ELISA
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-85432
Species: Hu, Mu
Applications: COMET, IHC,  IHC-P, mIF
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for BAT3/BAG6 Protein (NBP2-38693PEP) (0)

There are no publications for BAT3/BAG6 Protein (NBP2-38693PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAT3/BAG6 Protein (NBP2-38693PEP) (0)

There are no reviews for BAT3/BAG6 Protein (NBP2-38693PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BAT3/BAG6 Protein (NBP2-38693PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAT3/BAG6 Products

Research Areas for BAT3/BAG6 Protein (NBP2-38693PEP)

Find related products by research area.

Blogs on BAT3/BAG6

There are no specific blogs for BAT3/BAG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BAT3/BAG6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG6