Recombinant Human BAT3/BAG6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BAT3/BAG6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1033-1132 of Human BAT3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQRAFADDP

Protein/Peptide Type
Partial Recombinant Protein
Gene
BAG6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BAT3/BAG6 Protein

  • BAG6
  • BAT3
  • BAT3HLA-B associated transcript-3
  • BCL2-associated athanogene 6BAG-6
  • D6S52E
  • D6S52EHLA-B-associated transcript 3
  • G3BAG family molecular chaperone regulator 6
  • HLA-B associated transcript 3
  • large proline-rich protein BAT3
  • Protein G3
  • Protein Scythe
  • Scythe

Background

BAT3 - HLA-B associated transcript 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01) (0)

There are no publications for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01) (0)

There are no reviews for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BAT3/BAG6 Products

Bioinformatics Tool for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01)

Discover related pathways, diseases and genes to BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01)

Discover more about diseases related to BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01).
 

Pathways for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01)

View related products by pathway.

PTMs for BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01)

Learn more about PTMs related to BAT3/BAG6 Partial Recombinant Protein (H00007917-Q01).

Blogs on BAT3/BAG6

There are no specific blogs for BAT3/BAG6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BAT3/BAG6 Antibody
30230002-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BAT3/BAG6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BAG6
Entrez