BANF1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining in human fallopian tube and pancreas tissues using anti-BANF1 antibody. Corresponding BANF1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human liver shows low positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BANF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BANF1 Antibody - BSA Free (NBP2-38442) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BANF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BANF1 Protein (NBP2-38442PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BANF1 Antibody - BSA Free

• BAFMGC111161
• BANF1
• barrier to autointegration factor 1
• barrier-to-autointegration factor
• BCRG1
• BCRP1
• Breakpoint cluster region protein 1
• D14S1460

Background

BANF1 is encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for BANF1 Antibody (NBP2-38442) (1)

Average Rating: 2

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer ICC Mouse 01/31/2021

Summary

• Application: Immunocytochemistry
• Sample Tested: MEF,Mouse embryonic fibroblasts
• Species: Mouse
• Lot: R36005

Comments

• Comments: ICC of MEFs incubated overnight at 4C with１:25 diluted Ab (2 ug/ml) after fixation with 4% PFA for 15 min and permeabilization with 1% TritonX-100 for 10 min. ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: BANF1
• Uniprot:
  • O75531(Human)