BANF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BANF1 Antibody [NBP2-38442] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining in human fallopian tube and pancreas tissues using anti-BANF1 antibody. Corresponding BANF1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: BANF1 Antibody [NBP2-38442] - Staining of human cerebellum shows distinct nuclear membrane positivity in Purkinje cells.
Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BANF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC
Specificity
Specificity of human BANF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BANF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BANF1 Protein (NBP2-38442PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BANF1 Antibody

  • BAFMGC111161
  • barrier to autointegration factor 1
  • barrier-to-autointegration factor
  • BCRG1
  • BCRP1
  • Breakpoint cluster region protein 1
  • D14S1460

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for BANF1 Antibody (NBP2-38442) (0)

There are no publications for BANF1 Antibody (NBP2-38442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BANF1 Antibody (NBP2-38442) (0)

There are no reviews for BANF1 Antibody (NBP2-38442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BANF1 Antibody (NBP2-38442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BANF1 Antibody (NBP2-38442)

Discover related pathways, diseases and genes to BANF1 Antibody (NBP2-38442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BANF1 Antibody (NBP2-38442)

Discover more about diseases related to BANF1 Antibody (NBP2-38442).
 

Pathways for BANF1 Antibody (NBP2-38442)

View related products by pathway.

PTMs for BANF1 Antibody (NBP2-38442)

Learn more about PTMs related to BANF1 Antibody (NBP2-38442).
 

Research Areas for BANF1 Antibody (NBP2-38442)

Find related products by research area.

Blogs on BANF1

There are no specific blogs for BANF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BANF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BANF1
Uniprot