BAI2 Antibody (6A12) - Azide and BSA Free

Western Blot: BAI2 Antibody (6A12) [H00000576-M01] - Detection against Immunogen (35.31 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6A12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

BAI2 Antibody (6A12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BAI2 (NP_001694, 22 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
• Specificity: BAI2 - brain-specific angiogenesis inhibitor 2
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADGRB2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BAI2 Antibody (6A12) - Azide and BSA Free

• BAI2
• brain-specific angiogenesis inhibitor 2
• Brain-specific angiongenesis inhibitor-2

Background

BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRB2
• Entrez:
  • 576(Human)
• OMIM:
  • 602683(Human)
• Uniprot:
  • NP_001694(Human)