B7-H4 Recombinant Protein Antigen

Images

 
There are currently no images for B7-H4 Protein (NBP2-30536PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

B7-H4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VTCN1.

Source: E. coli

Amino Acid Sequence: ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VTCN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30536.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for B7-H4 Recombinant Protein Antigen

  • B7h.5
  • B7H4
  • B7-H4
  • B7H4T-cell costimulatory molecule B7x
  • B7S1
  • B7S1VCTN1
  • B7x
  • B7XPRO1291
  • FLJ22418
  • Immune costimulatory protein B7-H4
  • Protein B7S1
  • T cell costimulatory molecule B7x
  • V-set domain containing T cell activation inhibitor 1
  • V-set domain-containing T-cell activation inhibitor 1
  • Vtcn1

Background

B7H4 is a costimulatory protein which is reported to function as a negative regulator of T-cell mediated immunity. Although B7H4 binds an unknown receptor, it is thought to deliver an inhibitory signal to T-cells preventing their proliferation, cell cycle progression and interleukin-2 production. B7H4 deficient mice are only minimally affected, thus suggesting B7H4 is important in the fine tuning of the T-cell mediated immune response. B7H4 is expressed on activated T-cells, B-cells, monocytes and dendritic cells. Aberrant expression has been associated with cancers of the lung, breast and ovary in humans. B7H4 could be a useful prognostic marker in Renal Cell Carcinoma (RCC). There are three different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
7268-CT
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-76769
Species: Hu, Mu, Rt
Applications: Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-45549
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
AF1086
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
6507-IL/CF
Species: Hu
Applications: BA
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
MAB1224
Species: Hu
Applications: IHC, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
MAB7158
Species: Hu, Mu
Applications: IHC, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF169
Species: Hu
Applications: IHC, WB
AF1027
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Simple Western, WB
MAB165
Species: Hu
Applications: CyTOF-ready, Flow, Neut
NBP2-30536PEP
Species: Hu
Applications: AC

Publications for B7-H4 Protein (NBP2-30536PEP) (0)

There are no publications for B7-H4 Protein (NBP2-30536PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B7-H4 Protein (NBP2-30536PEP) (0)

There are no reviews for B7-H4 Protein (NBP2-30536PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for B7-H4 Protein (NBP2-30536PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B7-H4 Products

Research Areas for B7-H4 Protein (NBP2-30536PEP)

Find related products by research area.

Blogs on B7-H4

There are no specific blogs for B7-H4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our B7-H4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VTCN1