Recombinant Human B4GALNT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human B4GALNT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-328 of Human B4GALNT1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV

Protein/Peptide Type
Recombinant Protein
Gene
B4GALNT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
10 mM sodium citrate, pH 5.0 Reconstitute with deionized water.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human B4GALNT1 Protein

  • (N-acetylneuraminyl)-galactosylglucosylceramide
  • beta-1,4 N-acetylgalactosaminyltransferase 1
  • beta1,4GalNAc-T
  • beta-1,4-N-acetyl-galactosaminyl transferase 1
  • beta1-4GalNAc-T
  • GALGTEC 2.4.1.92
  • GALNACT
  • GalNAc-T
  • GD2 synthase, GM2 synthase
  • GM2/GD2 synthase
  • SIAT2
  • UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T)

Background

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP2-15533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBL1-16214
Species: Hu
H00002583-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for B4GALNT1 Recombinant Protein (H00002583-P01) (0)

There are no publications for B4GALNT1 Recombinant Protein (H00002583-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALNT1 Recombinant Protein (H00002583-P01) (0)

There are no reviews for B4GALNT1 Recombinant Protein (H00002583-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALNT1 Recombinant Protein (H00002583-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B4GALNT1 Products

Bioinformatics Tool for B4GALNT1 Recombinant Protein (H00002583-P01)

Discover related pathways, diseases and genes to B4GALNT1 Recombinant Protein (H00002583-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALNT1 Recombinant Protein (H00002583-P01)

Discover more about diseases related to B4GALNT1 Recombinant Protein (H00002583-P01).
 

Pathways for B4GALNT1 Recombinant Protein (H00002583-P01)

View related products by pathway.

Blogs on B4GALNT1

There are no specific blogs for B4GALNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human B4GALNT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALNT1