Home » B4GALNT1 » B4GALNT1 Antibodies » B4GALNT1 Antibody (5F9)

B4GALNT1 Antibody (5F9)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: B4GALNT1 Antibody (5F9) [H00002583-M02] - B4GALNT1 monoclonal antibody (M02), clone 5F9. Analysis of B4GALNT1 expression in PC-12.
Western Blot: B4GALNT1 Antibody (5F9) [H00002583-M02] - B4GALNT1 monoclonal antibody (M02), clone 5F9. Analysis of B4GALNT1 expression in PC-12.
Western Blot: B4GALNT1 Antibody (5F9) [H00002583-M02] - B4GALNT1 monoclonal antibody (M02), clone 5F9 Analysis of B4GALNT1 expression in HeLa.
Sandwich ELISA: B4GALNT1 Antibody (5F9) [H00002583-M02] - Detection limit for recombinant GST tagged B4GALNT1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

B4GALNT1 Antibody (5F9) Summary

Immunogen
B4GALNT1 (NP_001469, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS
Specificity
B4GALNT1 - beta-1,4-N-acetyl-galactosaminyl transferase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
B4GALNT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B4GALNT1 Antibody (5F9)

  • (N-acetylneuraminyl)-galactosylglucosylceramide
  • B4GALNT1
  • beta-1,4 N-acetylgalactosaminyltransferase 1
  • beta1,4GalNAc-T
  • beta-1,4-N-acetyl-galactosaminyl transferase 1
  • beta1-4GalNAc-T
  • GALGT
  • GALGTEC 2.4.1.92
  • GALNACT
  • GalNAc-T
  • GD2 Synthase
  • GD2 synthase, GM2 synthase
  • GM2 Synthase
  • GM2/GD2 synthase
  • SIAT2
  • SPG26
  • UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T)

Background

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ETFA Antibody
NBP2-16382
Immunoprecipitation: ETFA Antibody [NBP2-16382] - Immunoprecipitation of ETFA protein from HepG2 whole cell extracts using 5 ug of ETFA antibody. Western blot analysis was performed using ETFA antibody.
Immunohistochemistry-Paraffin: ETFA Antibody [NBP2-16382] - ETFA antibody detects ETFA protein at mitochondria on mouse liver by immunohistochemical analysis. Sample: Paraffin-embedded mouse heart. ETFA antibody dilution: 1:500.
Western Blot: ETFA Antibody [NBP2-16382] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ETFA antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Melan-A/MART-1
Antibody (A19-P)
NBP1-30151
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Human tissue (4 um section) stained with anti - Melan A monospecific clonal antibody.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Confocal microscopy image of human fetal inner ear tisue section stained with Melan-A antibody (green), 1:200 dilution, incubated over night. IHC-P image submitted by a verified customer review.
(4 Reviews)
(16 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Cathepsin A/Lysosomal Carboxypeptidase A was detected in immersion fixed paraffin-embedded sections of human prostate using Goat Anti-Human Cathepsin A/Lysosomal Carboxypeptidase A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1049) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, WB
MAG/Siglec-4a
538-MG
MAG/Siglec-4a
(19 Publications)
Species: Rt
Applications: BA
B3GALT4 Antibody
NBP2-15533
Western Blot: B3GALT4 Antibody [NBP2-15533] - Sample (30 ug of whole cell lysate) A: PC-3 B: U87-MG C: SK-N-SH 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: B3GALT4 Antibody [NBP2-15533] - Immunohistochemical analysis of paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
MAGEA3 Antibody
(6D10)
H00004102-M01
Western Blot: MAGEA3 Antibody (6D10) [H00004102-M01] - Analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: MAGEA3 Antibody (6D10) [H00004102-M01] - Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
FAK Antibody
(SR46-04)
NBP2-67327
Flow Cytometry: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of Hela cells with FAK antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: FAK Antibody (SR46-04) [NBP2-67327] - Staining FAK in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: FAK Antibody (SR46-04) [NBP2-67327] - Analysis of paraffin-embedded human spleen tissue using anti-FAK antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HGFR/c-MET
Antibody [Unconjugate
AF276
HGF R/c‑MET was detected in immersion fixed HT‑29 human colon adenocarcinoma cell line (positive control, left panel) and U937 human histiocytic lymphoma cell line (negative control, right panel) using Goat Anti-Human HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HGF R/c-MET was detected in immersion fixed paraffin-embedded sections of human skin using 15 µg/mL Goat Anti-Human HGF R/c-MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HGF R/c-Met knockout HeLa cell line (KO). PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HGF R/c‑MET Antigen Affinity-purified Polyclonal Antibody (Catalog # AF276) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for HGF R/c‑MET at approximately 150-200 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(24 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(177 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Niemann-Pick C1
Antibody - BSA Free
NB400-148
Knockout Validated: Niemann-Pick C1 Antibody [NB400-148] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and NPC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human NPC1 Polyclonal Antibody (Catalog # NB400-148) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for NPC1 at approximately 240-260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Niemann-Pick C1 Antibody [NB400-148] - Protein expression analysis of normal and NPC-deficient cells after HIV-1 infection. Cells were uninfected or infected with VSVG-HIV-1 and harvested 96 h post-infection. NPC2, NPC1, and beta-actin protein expression was detected via Western blotting in uninfected and infected cells. Gag expression was also detected in the infected cells. Image collected and cropped by CiteAb from the following publication (http://virologyj.biomedcentral.com/articles/10.1186/1743-422X-9-31), licensed under a CC-BY licence.
Knockdown Validated: Niemann-Pick C1 Antibody [NB400-148] - HeLa lysate, BHK lysate, A431 lysate tested at 1:1000. Image from verified customer review.
(6 Reviews)
(47 Publications)
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Pax3 was detected in immersion fixed B16‑F1 mouse melanoma cell line using Mouse Anti-Human/Mouse Pax3 Monoclonal Antibody (Catalog # MAB2457) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(348 Publications)
Species: Hu
Applications: BA
SLN Overexpression
Lysate
NBL1-16214
Western Blot: SLN Overexpression Lysate (Adult Normal) [NBL1-16214] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for SLN.
Species: Hu
Applications: WB
B4GALNT1 Antibody
(5F9)
H00002583-M02
B4GALNT1 Antibody (5F9)
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA

Publications for B4GALNT1 Antibody (H00002583-M02) (0)

There are no publications for B4GALNT1 Antibody (H00002583-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALNT1 Antibody (H00002583-M02) (0)

There are no reviews for B4GALNT1 Antibody (H00002583-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALNT1 Antibody (H00002583-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALNT1 Products

Bioinformatics Tool for B4GALNT1 Antibody (H00002583-M02)

Discover related pathways, diseases and genes to B4GALNT1 Antibody (H00002583-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALNT1 Antibody (H00002583-M02)

Discover more about diseases related to B4GALNT1 Antibody (H00002583-M02).
 

Pathways for B4GALNT1 Antibody (H00002583-M02)

View related products by pathway.

Blogs on B4GALNT1

There are no specific blogs for B4GALNT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALNT1 Antibody (5F9) and receive a gift card or discount.


Bioinformatics

Gene Symbol B4GALNT1
Entrez
OMIM
Uniprot