B4GALNT1 Antibody (5F9)

Images

 
Western Blot: B4GALNT1 Antibody (5F9) [H00002583-M02] - B4GALNT1 monoclonal antibody (M02), clone 5F9. Analysis of B4GALNT1 expression in PC-12.
Western Blot: B4GALNT1 Antibody (5F9) [H00002583-M02] - B4GALNT1 monoclonal antibody (M02), clone 5F9 Analysis of B4GALNT1 expression in HeLa.
Sandwich ELISA: B4GALNT1 Antibody (5F9) [H00002583-M02] - Detection limit for recombinant GST tagged B4GALNT1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

B4GALNT1 Antibody (5F9) Summary

Immunogen
B4GALNT1 (NP_001469, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS
Specificity
B4GALNT1 - beta-1,4-N-acetyl-galactosaminyl transferase 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
B4GALNT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for B4GALNT1 Antibody (5F9)

  • (N-acetylneuraminyl)-galactosylglucosylceramide
  • B4GALNT1
  • beta-1,4 N-acetylgalactosaminyltransferase 1
  • beta1,4GalNAc-T
  • beta-1,4-N-acetyl-galactosaminyl transferase 1
  • beta1-4GalNAc-T
  • GALGT
  • GALGTEC 2.4.1.92
  • GALNACT
  • GalNAc-T
  • GD2 Synthase
  • GD2 synthase, GM2 synthase
  • GM2 Synthase
  • GM2/GD2 synthase
  • SIAT2
  • SPG26
  • UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramideN-acetylgalactosaminyltransferase (GalNAc-T)

Background

GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-30151
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF1049
Species: Hu
Applications: IHC, WB
538-MG
Species: Rt
Applications: BA
NBP2-15533
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
202-IL
Species: Hu
Applications: BA
NBL1-16214
Species: Hu
Applications: WB
H00002583-M02
Species: Hu, Rt
Applications: WB, ELISA, S-ELISA

Publications for B4GALNT1 Antibody (H00002583-M02) (0)

There are no publications for B4GALNT1 Antibody (H00002583-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B4GALNT1 Antibody (H00002583-M02) (0)

There are no reviews for B4GALNT1 Antibody (H00002583-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for B4GALNT1 Antibody (H00002583-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional B4GALNT1 Products

Bioinformatics Tool for B4GALNT1 Antibody (H00002583-M02)

Discover related pathways, diseases and genes to B4GALNT1 Antibody (H00002583-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for B4GALNT1 Antibody (H00002583-M02)

Discover more about diseases related to B4GALNT1 Antibody (H00002583-M02).
 

Pathways for B4GALNT1 Antibody (H00002583-M02)

View related products by pathway.

Blogs on B4GALNT1

There are no specific blogs for B4GALNT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our B4GALNT1 Antibody (5F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol B4GALNT1
Entrez
OMIM
Uniprot